Property Summary

NCBI Gene PubMed Count 190
Grant Count 157
R01 Count 85
Funding $15,127,624.59
PubMed Score 674.64
PubTator Score 478.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
osteosarcoma -1.234 0.001
intraductal papillary-mucinous neoplasm ... 1.500 0.007
progressive supranuclear palsy -1.100 0.018
ovarian cancer -1.900 0.000

Synonym

Accession P23025 Q5T1U9 Q6LCW7 Q6LD02
Symbols XP1
XPAC

Gene

XPA

PDB

1D4U   1XPA   2JNW  

Gene RIF (161)

PMID Text
26805762 Upon UVC radiation, Nlp interacts with XPA and ERCC1, and enhances their association
26743599 a specific XPA genotype is associated with mild phenotype in Xeroderma Pigmentosum in United Kingdom immigrants from India, Pakistan, and Afghanistan
26578599 Data suggest an association of high mobility group box 1 (HMGB1) with xeroderma pigmentosum complementation group A (XPA) protein facilitates the formation of a favorable architectural environment for DNA interstrand crosslinks (ICLs) repair processing.
26559182 The lack of XPA significantly enhanced the mutant proportion of tandem 8-oxoG in the transcribed strand (12%) compared with that in TSCER122 cells (7.4%) but not in the non-transcribed strand.
26384665 A tripartite lesion verification mechanism involving XPC, TFIIH, and XPA is necessary for efficient nucleotide excision repair.
26156020 Findings suggest that xeroderma pigmentosum complementation group-A (XPA) levels may be a potential predictor of prognosis in locally advanced nasopharyngeal carcinoma (NPC) patients treated with platinum-based chemoradiotherapy.
25973722 The role of conformational selection in the molecular recognition of the wild type and mutants XPA67-80 peptides by ERCC1 has been described.
25913378 Xeroderma pigmentosum syndrome is rarely associated with inherited disease-causing XPA mutations in the Brazilian population.
25566891 Homozygous mutations in the XPA gene were seen in xeroderma pigmentosum patients with moderate to severe mental retardation (6/10 families) but not in those without neurological features.
25474887 XPA single nucleotide polymorphism and gene frequency in Russians, Tatars and Bashkirs.
More...

AA Sequence

MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIID      1 - 70
TGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLIT     71 - 140
KTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQEN    141 - 210
REKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM           211 - 273
//

Text Mined References (196)

PMID Year Title
26805762 2016 Mitotic regulator Nlp interacts with XPA/ERCC1 complexes and regulates nucleotide excision repair (NER) in response to UV radiation.
26743599 2016 A Distinct Genotype of XP Complementation Group A: Surprisingly Mild Phenotype Highly Prevalent in Northern India/Pakistan/Afghanistan.
26578599 2016 HMGB1 interacts with XPA to facilitate the processing of DNA interstrand crosslinks in human cells.
26559182 2015 Xeroderma Pigmentosum Group A Suppresses Mutagenesis Caused by Clustered Oxidative DNA Adducts in the Human Genome.
26384665 2015 Tripartite DNA Lesion Recognition and Verification by XPC, TFIIH, and XPA in Nucleotide Excision Repair.
26156020 2015 High expression of XPA confers poor prognosis for nasopharyngeal carcinoma patients treated with platinum-based chemoradiotherapy.
25973722 2015 The role of conformational selection in the molecular recognition of the wild type and mutants XPA67-80 peptides by ERCC1.
25913378 2015 Xeroderma pigmentosum: low prevalence of germline XPA mutations in a Brazilian XP population.
25566891 Clinical profile and mutation analysis of xeroderma pigmentosum in Indian patients.
25474887 2013 [Polymorphism of DNA repair genes (XRCC1, XRCC3, XPC, XPD, XPA) in ethnic groups from Republic of Bashkortostan].
More...