Property Summary

NCBI Gene PubMed Count 36
PubMed Score 615.62
PubTator Score 48.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma 4.044 2.7e-02

Gene RIF (19)

AA Sequence

MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEY      1 - 70
QRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFY     71 - 140
ELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE                                    141 - 178
//

Text Mined References (37)

PMID Year Title