Property Summary

NCBI Gene PubMed Count 170
Grant Count 328
R01 Count 139
Funding $55,980,389.93
PubMed Score 2172.36
PubTator Score 514.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -6.320 0.000
mucosa-associated lymphoid tissue lympho... 5.318 0.010

Synonym

Accession P22894 Q45F99
Symbols HNC
CLG1
MMP-8
PMNL-CL

Gene

PDB

1A85   1A86   1BZS   1I73   1I76   1JAN   1JAO   1JAP   1JAQ   1JH1   1JJ9   1KBC   1MMB   1MNC   1ZP5   1ZS0   1ZVX   2OY2   2OY4   3DNG   3DPE   3DPF   3TT4   4QKZ  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2067 screening 9 / 0 / 0 Late stage results from the probe development efforts to identify inhibitors of Matrix Metalloproteinase-13 (MMP-13).

Gene RIF (138)

PMID Text
27442388 Suggest that MMP-8 polymorphism -799 C/T was a risk for developing chronic periapical lesions.
26872724 The reciprocal positive interplay between MMP-8 and TGF-beta1 contributes to HCC invasion and metastasis by inducing EMT mainly through the PI3K/Akt/Rac1 pathway.
26773532 EMMPRIN, MMP8, hyaluronan, beta-defensing-2, and neutrophil gelatinase-associated lipocalin (NGAL) are elevated in women with vaginal inflammation
26577236 Initial analysis of the MMP8 gene showed suggestive association between rs1940475 and knee OA, but the finding did not replicate in other study cohorts, even though the trend for predisposing allele was similar in all five cohorts. MMP-8 is a good biological candidate for OA, but our study did not find common variants with significant association in the gene.
26462905 amniotic fluid concentrations in acute-chorioamnionitis distinctly decrease throughout preterm-gestation
26418236 Sputum, serum, and urine MMP-8 were not significantly changed in COPD exacerbation compared to recovery values.
26339374 miR-539 plays a key role in inhibiting osteosarcoma cell invasion and migration and can regulate MMP8 expression in osteosarcoma cells.
26132583 salivary levels of the analyzed biomarkers MMP-8, -9, MPO are associated with periodontal status. However, these biomarkers could not differentiate between patients with or without a MI.
25841875 Positive results of the aMMP-8 test significantly correlate with generalized ChP. The aMMP-8 test may be used by physicians to detect periodontitis in their patients.
25712810 increased levels in saliva and serum in women with polycystic ovary syndrome, and is potentiated in the presence of gingivitis
More...

AA Sequence

MFSLKTLPFLLLLHVQISKAFPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFF      1 - 70
GLNVTGKPNEETLDMMKKPRCGVPDSGGFMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELW     71 - 140
SVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYN    141 - 210
LFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCD    211 - 280
PSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYW    281 - 350
ALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGI    351 - 420
ESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG                           421 - 467
//

Text Mined References (170)

PMID Year Title
27442388 2015 Matrix Matalloproteinase-8 Gene Polymorphism in Chronic Periapical Lesions.
26872724 2016 Reciprocal activation between MMP-8 and TGF-?1 stimulates EMT and malignant progression of hepatocellular carcinoma.
26773532 2016 Vaginal Inflammation: Association between Leukocyte Concentration and Levels of Immune Mediators.
26577236 2016 Association study of MMP8 gene in osteoarthritis.
26462905 2015 The inflammatory milieu of amniotic fluid in acute-chorioamnionitis decreases with increasing gestational age.
26418236 2016 Matrix metalloproteinases -8 and -9 in the Airways, Blood and Urine During Exacerbations of COPD.
26339374 2015 MicroRNA-539 suppresses osteosarcoma cell invasion and migration in vitro and targeting Matrix metallopeptidase-8.
26132583 2015 Salivary Matrix Metalloproteinase-8 and -9 and Myeloperoxidase in Relation to Coronary Heart and Periodontal Diseases: A Subgroup Report from the PAROKRANK Study (Periodontitis and Its Relation to Coronary Artery Disease).
25841875 2015 Activated matrix metalloproteinase-8 in saliva as diagnostic test for periodontal disease? A case-control study.
25712810 2015 Elevated matrix metalloproteinase-8 in saliva and serum in polycystic ovary syndrome and association with gingival inflammation.
More...