Property Summary

NCBI Gene PubMed Count 89
PubMed Score 16.96
PubTator Score 5.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 7.6e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acute chest syndrome 9 3.367 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 7.6e-06

 GWAS Trait (1)

Gene RIF (82)

AA Sequence

MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYEEICVYEEARE      1 - 70
VFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHF     71 - 140
CLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRE    141 - 210
NFVLTTAKCSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPV    211 - 280
CTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMH    281 - 350
WMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMN                        351 - 400
//

Text Mined References (91)

PMID Year Title