Property Summary

NCBI Gene PubMed Count 84
PubMed Score 17.08
PubTator Score 5.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
PROTEIN Z DEFICIENCY 1
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 0.000

Synonym

Accession P22891 A6NMB4 Q15213 Q5JVF5 Q5JVF6
Symbols PZ

Gene

PDB

3F1S   3H5C  

Gene RIF (77)

PMID Text
25713144 Results show the energetic basis of the Z-dependent protease inhibitor (ZPI)-protein Z (PZ) interaction and suggest an important role for ZPI Lys-239 in PZ catalytic action.
24960590 Protein Z EGF2 subdomain constitutes an interactive-site for ZPI protein.
24907135 There was no significant difference in the clinical features of the patients with and without the polymorphism. We therefore conclude that PZ G79A polymorphism is not a risk factor for puerperal CVT in Indian women.
24315319 The unbalance between PZ and ZPI in plasma samples from patients with Colorectal Cancer or Pancreatic Cancer is not only related to an inflammatory state but could also results from an ectopic synthesis of these proteins by the cancer cells.
24158387 Protein Z/protein Z-dependent protease inhibitor and Fxa expression in human gastric cancer cells indicate that these proteins may play a role in anticoagulant events at the tumor tissue.
23846529 active mutations of PZ in the serine protease structural domain were found in women with fetal loss
23690629 Data suggest role for complex of PZ with ZPI (PZ-dependent protease inhibitor) in pregnancy maintenance; this is highlighted by progressive elevation in PZ levels in first trimester of gestation which then steadily decline toward delivery. [REVIEW]
23420821 Specific PZSNPs and haplotypes are significantly associated with idiopathic recurrent miscarriage.
23269381 the PZ/ZPI complex may play some modulating role in hemophilia A
22960740 74 patients a protein Z deficiency has been found.
More...

AA Sequence

MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYEEICVYEEARE      1 - 70
VFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHF     71 - 140
CLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRE    141 - 210
NFVLTTAKCSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPV    211 - 280
CTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMH    281 - 350
WMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMN                        351 - 400
//

Text Mined References (86)

PMID Year Title
25713144 2015 Thermodynamic and kinetic characterization of the protein Z-dependent protease inhibitor (ZPI)-protein Z interaction reveals an unexpected role for ZPI Lys-239.
24960590 2014 Characterization of the protein Z-dependent protease inhibitor interactive-sites of protein Z.
24907135 2015 Protein Z G79A polymorphism and puerperal cerebral venous thrombosis.
24315319 2014 Unbalance between plasma levels of Protein Z and protein Z-dependent inhibitor in patients with colorectal and pancreatic cancer: a pilot study.
24158387 2014 Protein Z/protein Z-dependent protease inhibitor system in loco in human gastric cancer.
23846529 2013 Structural analysis of protein Z gene variants in patients with foetal losses.
23690629 2013 Protein Z, an anticoagulant protein with expanding role in reproductive biology.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23420821 2013 Protein Z variants associated with protein Z plasma levels and with risk of idiopathic recurrent miscarriage.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...