Property Summary

NCBI Gene PubMed Count 202
Grant Count 46
R01 Count 30
Funding $2,880,443.45
PubMed Score 355.61
PubTator Score 936.55

Knowledge Summary

Patent (41,582)

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer -2.400 0.000
subependymal giant cell astrocytoma 2.284 0.037
ductal carcinoma in situ -1.200 0.023
psoriasis -1.700 0.000

 GWAS Trait (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1402 confirmatory 0 / 2 / 29 Counterscreen for Agonists of Thyroid Stimulating Hormone Receptor: HTRF Activity in a Luteinizing Hormone Receptor Cell Line
504385 confirmatory 1 / 0 / 6 Counterscreen for antagonists of the thyroid stimulating hormone receptor: ELISA activity in a Luteinizing Hormone Receptor cell line
602293 confirmatory 29 / 125 / 1130 qHTS for antagonists of the Thyroid Stimulation Hormone Receptor: Hit Validation in HTRF Activity in a Luteinizing Hormone Receptor Cell Line

Gene RIF (162)

PMID Text
26831561 Data indicate two patients with peripheral precocious puberty and an activating mutation in the luteinizing hormone (LH))/choriogonadotropin receptor (LHCGR) gene.
26679164 The expression of miR-592 and its effects on LHCG receptors in patients with polycystic ovary syndrome and normal controls are described.
26663062 Data suggest that rs13405728 single nucleotide polymorphism of the luteinizing hormone receptor (LHR) gene may be associated with slow ovarian response in assisted reproductive technology (ART).
26662070 LHbeta G1052A and LHCGR G935A genes polymorphisms are associated with increased risk of polycystic ovary syndrome in Egyptian women especially in obese cases.
26112185 the LHR can act in an invertebrate demonstrates the conservation of factors required for GPCR function among phylogenetically distant organisms.
25935136 The insLQ polymorphism within LHR is associated with endometriosis and infertility.
25916694 Melatonin affects the secretion of GnRH, LH and testosterone, improves sperm quality thereby regulating the testicular development and male reproduction. (Review)
25795638 affected patients were all homozygous for a novel mutation in the LHCGR gene, a deletion of guanine in position 1850 (1850delG);the novel LHCGR mutation leads to complete inactivation of the LHCGR receptor due to trafficking and signaling abnormalities
25676660 LHCGR levels in circulation predicts early and late preeclampsia in first trimester of pregnancy.
25670721 Demonstrate the presence of LH receptors. Activation resulted in a dose-dependent increase in glucose-induced release of insulin.
More...

AA Sequence

MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPVKVIPSQAFR      1 - 70
GLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPD     71 - 140
VTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHL    141 - 210
EKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCC    211 - 280
AFRNLPTKEQNFSHSISENFSKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAF    281 - 350
NPCEDIMGYDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS    351 - 420
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRLRHAILIMLGG    421 - 490
WLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFFIICACYIKIYFAVRNPELMA    491 - 560
TNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTF    561 - 630
QRDFFLLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC     631 - 699
//

Text Mined References (209)

PMID Year Title
26831561 2015 Testotoxicosis: Report of Two Cases, One with a Novel Mutation in LHCGR Gene.
26679164 2015 miRNA-592 is downregulated and may target LHCGR in polycystic ovary syndrome patients.
26663062 2015 [Association of rs13405728 polymorphism of LHR gene with slow ovarian response].
26662070 2016 Association between genes encoding components of the Leutinizing hormone/Luteinizing hormone-choriogonadotrophin receptor pathway and polycystic ovary syndrome in Egyptian women.
26112185 2015 The LH/CG receptor activates canonical signaling pathway when expressed in Drosophila.
25935136 2015 LH (Trp8Arg/Ile15Thr), LHR (insLQ) and FSHR (Asn680Ser) polymorphisms genotypic prevalence in women with endometriosis and infertility.
25916694 2015 Melatonin and male reproduction.
25795638 2015 A novel inactivating mutation of the LH/chorionic gonadotrophin receptor with impaired membrane trafficking leading to Leydig cell hypoplasia type 1.
25676660 2015 Forms of Circulating Luteinizing Hormone Human Chorionic Gonadotropin Receptor for the Prediction of Early and Late Preeclampsia in the First Trimester of Pregnancy.
25670721 2015 The Presence of Human Chorionic Gonadotropin/Luteinizing Hormone Receptors in Pancreatic ?-Cells.
More...