Property Summary

Ligand Count 3
NCBI Gene PubMed Count 211
PubMed Score 376.43
PubTator Score 936.55

Knowledge Summary

Patent (41,582)

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 4.1e-21
colon cancer 1478 2.3e-08
ductal carcinoma in situ 1745 2.3e-02
subependymal giant cell astrocytoma 2287 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 4.681 2.3

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer -2.400 2.3e-08
ductal carcinoma in situ -1.200 2.3e-02
psoriasis -1.700 4.1e-21
subependymal giant cell astrocytoma 2.284 3.7e-02

Gene RIF (170)

AA Sequence

MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPVKVIPSQAFR      1 - 70
GLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPD     71 - 140
VTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHL    141 - 210
EKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCC    211 - 280
AFRNLPTKEQNFSHSISENFSKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAF    281 - 350
NPCEDIMGYDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS    351 - 420
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRLRHAILIMLGG    421 - 490
WLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFFIICACYIKIYFAVRNPELMA    491 - 560
TNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTF    561 - 630
QRDFFLLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC     631 - 699
//

Text Mined References (218)

PMID Year Title