Property Summary

NCBI Gene PubMed Count 87
PubMed Score 528.23
PubTator Score 464.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 4.9e-02
cystic fibrosis -1.200 7.3e-05
group 3 medulloblastoma 1.100 3.3e-03
lung cancer 2.400 3.7e-03
osteosarcoma -3.218 5.5e-05
ovarian cancer -1.800 2.7e-12
pancreatic ductal adenocarcinoma liver m... -1.040 5.9e-04
Pick disease -1.500 5.2e-05
pituitary cancer 1.200 6.2e-03
psoriasis 1.300 1.0e-03
sarcoidosis 1.100 4.1e-02

Protein-protein Interaction (11)

Gene RIF (50)

AA Sequence

MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTG      1 - 70
ILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQG     71 - 140
EGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYY    141 - 210
NQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEV    211 - 280
SATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDI    281 - 350
EYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTS    351 - 420
QQL                                                                       421 - 423
//

Text Mined References (89)

PMID Year Title