Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $98,805.8
PubMed Score 0.44
PubTator Score 14.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.842 0.022

Gene RIF (2)

PMID Text
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18976975 Knockdown of carboxypeptidase N, polypeptide 2 (CPN2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MLPGAWLLWTSLLLLARPAQPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFG      1 - 70
SNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLNFNMLEALPEGL     71 - 140
FQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNLLAQLPEELFHPLTSLQTLKLSNNALSGLPQ    141 - 210
GVFGKLGSLQELFLDSNNISELPPQVFSQLFCLERLWLQRNAITHLPLSIFASLGNLTFLSLQWNMLRVL    211 - 280
PAGLFAHTPCLVGLSLTHNQLETVAEGTFAHLSNLRSLMLSYNAITHLPAGIFRDLEELVKLYLGSNNLT    281 - 350
ALHPALFQNLSKLELLSLSKNQLTTLPEGIFDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNI    351 - 420
QTYCAGPAYLKGQVVPALNEKQLVCPVTRDHLGFQVTWPDESKAGGSWDLAVQERAARSQCTYSNPEGTV    421 - 490
VLACDQAQCRWLNVQLSPQQGSLGLQYNASQEWDLRSSCGSLRLTVSIEARAAGP                   491 - 545
//

Text Mined References (13)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...