Property Summary

NCBI Gene PubMed Count 23
PubMed Score 25.60
PubTator Score 90.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -4.343 8.5e-07
aldosterone-producing adenoma -2.638 1.7e-02
intraductal papillary-mucinous adenoma (... 2.400 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.800 4.7e-02
invasive ductal carcinoma -1.600 2.2e-02
lung adenocarcinoma -1.200 5.4e-04
lung cancer -1.100 1.5e-02
lung carcinoma -1.600 2.8e-07
malignant mesothelioma -3.300 6.5e-08
ovarian cancer -2.900 4.3e-07
pancreatic cancer -3.000 1.5e-05
pancreatic ductal adenocarcinoma liver m... -2.575 9.3e-04
periodontitis -1.300 2.3e-24

Gene RIF (10)

AA Sequence

MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDE      1 - 70
VPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVV     71 - 140
VSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKI    141 - 210
KLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKF    211 - 280
VNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL    281 - 350
MYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL                         351 - 399
//

Text Mined References (28)

PMID Year Title