Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.25
PubTator Score 90.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P22760 A8K3L3 D3DNJ6 Q8N1A9
Symbols DAC
CES5A1

Gene

PANTHER Protein Class (2)

Gene RIF (8)

PMID Text
26444075 AADAC deletion is a candidate susceptibility factor for Gilles de la Tourette Syndrome
24125761 Translational N-glycosylation of AADAC plays a crucial role in regulating AADAC enzyme activity.
23542347 Lipolysis of cellular TG and VLDL production were impaired in HCV infected cells during the early peak of viral infection. This was partially explained by an apparent deficiency of a putative TG lipase, arylacetamide deacetylase (AADAC).
22415931 An AADAC*3 allele yields decreased enzyme activity in liver microsomes.
21856291 human AADAC was the enzyme responsible for the deacetylation of rifamycins and would affect the induction rate of drug-metabolizing enzymes by rifamycins and their induced hepatotoxicity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
10318829 two intrinsic endoplasmic reticulum (ER) proteins, 11beta-hydroxysteroid dehydrogenase, isozyme 1 (11beta-HSD) and the 50-kDa esterase (E3), sharing some amino acid sequence motifs in their N-terminal transmembrane (TM) domains.

AA Sequence

MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDE      1 - 70
VPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVV     71 - 140
VSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKI    141 - 210
KLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKF    211 - 280
VNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL    281 - 350
MYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL                         351 - 399
//

Text Mined References (26)

PMID Year Title
26444075 2016 Association of AADAC Deletion and Gilles de la Tourette Syndrome in a Large European Cohort.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125761 2014 N-Glycosylation during translation is essential for human arylacetamide deacetylase enzyme activity.
23542347 2013 Arylacetamide deacetylase: a novel host factor with important roles in the lipolysis of cellular triacylglycerol stores, VLDL assembly and HCV production.
22415931 2012 A novel polymorphic allele of human arylacetamide deacetylase leads to decreased enzyme activity.
22207054 2012 Species differences in tissue distribution and enzyme activities of arylacetamide deacetylase in human, rat, and mouse.
21856291 2011 Human arylacetamide deacetylase is responsible for deacetylation of rifamycins: rifampicin, rifabutin, and rifapentine.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
More...