Property Summary

NCBI Gene PubMed Count 65
PubMed Score 381.45
PubTator Score 207.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis 1.100 3.5e-03
cutaneous lupus erythematosus 3.200 2.7e-04
head and neck cancer and chronic obstruc... 1.500 1.3e-02
interstitial cystitis 1.100 6.6e-03
lung adenocarcinoma -1.885 1.2e-07
lung cancer -1.100 4.6e-03
lung carcinoma -1.300 8.1e-09
Multiple Sclerosis -1.100 3.0e-02
nasopharyngeal carcinoma 1.200 1.1e-03
nephrosclerosis 1.173 1.2e-02
non-small cell lung cancer -1.483 8.3e-10
osteosarcoma -2.147 1.2e-02
psoriasis 1.800 1.5e-40
type I diabetes mellitus -1.234 1.3e-02

Gene RIF (53)

AA Sequence

MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL      1 - 70
TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP     71 - 140
STGPL                                                                     141 - 145
//

Text Mined References (65)

PMID Year Title