Property Summary

NCBI Gene PubMed Count 62
Grant Count 84
R01 Count 36
Funding $19,996,480.84
PubMed Score 358.36
PubTator Score 207.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis 1.503 0.006
cutaneous lupus erythematosus 3.600 0.000
osteosarcoma -2.710 0.010
Atopic dermatitis 1.100 0.004
non-small cell lung cancer -1.561 0.000
lung cancer -2.900 0.000
Multiple Sclerosis -1.100 0.030
interstitial cystitis 1.300 0.001
nasopharyngeal carcinoma 1.400 0.001
lung adenocarcinoma -1.885 0.000
lung carcinoma -1.300 0.000
type I diabetes mellitus -1.234 0.013
head and neck cancer and chronic obstruc... 1.800 0.009
psoriasis 1.800 0.000

Synonym

Accession P22749 P09325 Q6GU08
Symbols LAG2
NKG5
LAG-2
D2S69E
TLA519

Gene

PDB

1L9L  

Gene RIF (50)

PMID Text
26752517 GNLY delivers Gzms into three protozoan parasites (Trypanosoma cruzi, Toxoplasma gondii and Leishmania major), in which the Gzms generate superoxide and inactivate oxidative defense enzymes to kill the parasite.
26751807 serum GNLY is closely associated with the clinical characteristics of nasopharyngeal carcinoma and may be a potential biomarker for nasopharyngeal carcinoma
26314314 Studies indicate that cytotoxic mechanisms mediated by granulysin and TRAIL (TNF-related apoptosis inducing ligand) seem to be less secondary effects on normal tissues.
26225678 High Granulysin expression is associated with Cutaneous T Cell Lymphoma and Sezary Syndrome.
25644528 A three-way interaction between SNPs in HLA-DQ and GNLY was identified in terms of HBV clearance.
24906149 Human, but not rodent, cytotoxic granules also contain granulysin, an antimicrobial peptide in addition to granzymes; study shows that granulysin delivers granzymes into bacteria to kill diverse bacterial strains.
24269628 It was concluded taht granulysin induces apoptosis on hematological tumor cells and on cells from B-cell lymphocytic leukemia patients, opening the door to research on its use as a new anti-tumoral treatment.
24035442 Serum granulysin levels were significantly elevated in both acute and chronic alopecia areata patients.
23801887 suggested that the alteration of circulating granulysin has potential function in host immune response against TB and HIV/TB coinfection
23399514 study to determine: expression of GNLY at the gene and protein levels at the maternal-fetal interface, relationship(s) between GNLY and perforin, and GNLY secretion by stimulated NK cells
More...

AA Sequence

MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL      1 - 70
TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP     71 - 140
STGPL                                                                     141 - 145
//

Text Mined References (62)

PMID Year Title
26752517 2016 Killer lymphocytes use granulysin, perforin and granzymes to kill intracellular parasites.
26751807 2016 Evaluation of serum granulysin as a potential biomarker for nasopharyngeal carcinoma.
26314314 2015 Death ligands and granulysin: mechanisms of tumor cell death induction and therapeutic opportunities.
26225678 2015 Expression of Granulysin and FOXP3 in Cutaneous T Cell Lymphoma and Sézary Syndrome.
25644528 2015 Effects of interaction between genetic variants in human leukocyte antigen DQ and granulysin genes in Chinese Han subjects infected with hepatitis B virus.
24906149 2014 Cytotoxic cells kill intracellular bacteria through granulysin-mediated delivery of granzymes.
24269628 2014 Granulysin induces apoptotic cell death and cleavage of the autophagy regulator Atg5 in human hematological tumors.
24035442 2014 Serum granulysin as a possible key marker of the activity of alopecia areata.
23801887 2013 Potential function of granulysin, other related effector molecules and lymphocyte subsets in patients with TB and HIV/TB coinfection.
23399514 2013 Granulysin expression and the interplay of granulysin and perforin at the maternal-fetal interface.
More...