Property Summary

NCBI Gene PubMed Count 48
PubMed Score 1407.67
PubTator Score 420.60

Knowledge Summary


No data available


  Disease Sources (5)

Disease Target Count
Retinitis pigmentosa 17 1
Disease Target Count P-value
non-small cell lung cancer 2798 6.79922555145127E-32
lung adenocarcinoma 2714 9.79786298813917E-22
psoriasis 6685 1.61724624742427E-17
lung carcinoma 2844 5.76747910725289E-16
osteosarcoma 7933 3.1673487901046E-6
group 3 medulloblastoma 2254 1.17703951696554E-5
colon cancer 1475 1.39752200212825E-5
ductal carcinoma in situ 1745 2.12150811809053E-5
ulcerative colitis 2087 1.17205798349836E-4
invasive ductal carcinoma 2950 1.43791967525477E-4
lung cancer 4473 1.88867826047735E-4
pilocytic astrocytoma 3086 2.69544585544529E-4
pediatric high grade glioma 2712 4.63620644320029E-4
pancreatic cancer 2300 4.69353886500591E-4
glioblastoma 5572 5.84282985874793E-4
interstitial cystitis 2299 0.00195761630789172
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00521302221471944
astrocytic glioma 2241 0.00735613434636731
medulloblastoma, large-cell 6234 0.00860778150470657
gastric carcinoma 832 0.00872740702079142
primitive neuroectodermal tumor 3031 0.0166677261485088
subependymal giant cell astrocytoma 2287 0.0197189223182816
pituitary cancer 1972 0.0247320630135636
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0268527752215068
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0274671592875978
spina bifida 1064 0.0407734452079813
Disease Target Count
Retinitis pigmentosa 156


  Differential Expression (26)


Accession P22748 B4DQA4 Q6FHI7
Symbols CAIV



PANTHER Protein Class (2)


1ZNC   3F7B   3F7U   3FW3  

  Ortholog (10)

Gene RIF (20)

24880201 Carbonic anhydrase 4 is lost in papillary thyroid carcinoma but not thyroid nodules
24338019 Coexpression of CAIV with MCT1 and MCT4 resulted in a significant increase in MCT transport activity.
24146379 Although CA IV has been shown to be active in mediating CO2 and HCO3 (-) transport in many important tissues like kidney and lung, and in isolated cells from brain and muscle, the gene for CA IV appears not to be essential.
23297198 membrane-associated CA IV contributes robust catalytic activity intracellularly, and this activity participates in regulating H(+) dynamics in the cytosol
23049597 The generation of CA III and IV autoantibodies, antioxidant enzymes, and cytokines might influence each other.
22021688 Two SNPs of carbonic anhydrase IV, which are responsible for amino acid changes, were found. The frequencies of these SNPs were not significantly different between the caries-free group and the group with caries
21680735 data suggest that extracellular membrane-bound CAIV, but not cytosolic CAII, augments transport activity of MCT2 in a non-catalytic manner, possibly by facilitating a proton pathway other than His-88
20801516 Observational study of genetic testing. (HuGE Navigator)
20626030 compared the subcellular localization and post-translational processing of wild-type (WT)- and retinitis pigmentosa 17 mutant-CAIV in three cell types
20450258 The results suggest that the expression level of carbonic anhydrase IV may be important to maintain retina function in retinitis pigmentosa.

AA Sequence

VIKSGAPGRPLPWALPALLGPMLACLLAGFLR                                          281 - 312

Text Mined References (58)

PMID Year Title
24880201 2014 Carbonic anhydrase 4 and crystallin ?-B immunoreactivity may distinguish benign from malignant thyroid nodules in patients with indeterminate thyroid cytology.
24338019 2014 Intracellular and extracellular carbonic anhydrases cooperate non-enzymatically to enhance activity of monocarboxylate transporters.
24146379 2014 Membrane associated carbonic anhydrase IV (CA IV): a personal and historical perspective.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23297198 2013 GPI-anchored carbonic anhydrase IV displays both intra- and extracellular activity in cRNA-injected oocytes and in mouse neurons.
23049597 2012 Carbonic anhydrases III and IV autoantibodies in rheumatoid arthritis, systemic lupus erythematosus, diabetes, hypertensive renal disease, and heart failure.
22021688 Carbonic anhydrase VI exon 2 genetic polymorphism in Turkish subjects with low caries experience (preliminary study).
21680735 2011 Transport activity of the high-affinity monocarboxylate transporter MCT2 is enhanced by extracellular carbonic anhydrase IV but not by intracellular carbonic anhydrase II.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.