Property Summary

NCBI Gene PubMed Count 48
Grant Count 90
R01 Count 52
Funding $27,508,862.14
PubMed Score 1407.67
PubTator Score 420.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Epilepsy 346 5.172 2.6
Herpangina 9 4.599 2.3
Alzheimer's disease 644 4.397 2.2
Cancer 2,346 4.111 2.1
Influenza 142 3.754 1.9
Vascular disease 281 3.733 1.9
Schizophrenia 501 3.669 1.8
Glaucoma 134 3.614 1.8
Retinitis pigmentosa 153 3.576 1.8
Dementia 129 3.389 1.7
Toxic encephalopathy 131 3.08 1.5
Bipolar Disorder 266 3.047 1.5
Absence seizure 12
Anoxia due to high altitude 4
Edema 38
Epilepsy characterized by intractable co... 28 
Lennox-Gastaut syndrome 34
Malignant glaucoma 4
Migraine Prevention 22
Open-angle glaucoma 26
Peripheral Edema due to Chronic Heart Fa... 10 
Peripheral edema 4
Retinitis Pigmentosa 17 1
Secondary glaucoma 5
Simple partial seizure 26
Tonic-clonic epilepsy 47
angle-closure glaucoma 7
astrocytic glioma 2,241
colon cancer 1,475
ductal carcinoma in situ 1,745
gastric carcinoma 832
glioblastoma 5,572
group 3 medulloblastoma 2,254
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
osteosarcoma 7,933
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031
psoriasis 6,685
spina bifida 1,064
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

  Differential Expression (26)

Synonym

Accession P22748 B4DQA4 Q6FHI7
Symbols CAIV
Car4
RP17

Gene

CA4

PANTHER Protein Class (2)

PDB

1ZNC   3F7B   3F7U   3FW3  

Gene RIF (20)

PMID Text
24880201 Carbonic anhydrase 4 is lost in papillary thyroid carcinoma but not thyroid nodules
24338019 Coexpression of CAIV with MCT1 and MCT4 resulted in a significant increase in MCT transport activity.
24146379 Although CA IV has been shown to be active in mediating CO2 and HCO3 (-) transport in many important tissues like kidney and lung, and in isolated cells from brain and muscle, the gene for CA IV appears not to be essential.
23297198 membrane-associated CA IV contributes robust catalytic activity intracellularly, and this activity participates in regulating H(+) dynamics in the cytosol
23049597 The generation of CA III and IV autoantibodies, antioxidant enzymes, and cytokines might influence each other.
22021688 Two SNPs of carbonic anhydrase IV, which are responsible for amino acid changes, were found. The frequencies of these SNPs were not significantly different between the caries-free group and the group with caries
21680735 data suggest that extracellular membrane-bound CAIV, but not cytosolic CAII, augments transport activity of MCT2 in a non-catalytic manner, possibly by facilitating a proton pathway other than His-88
20801516 Observational study of genetic testing. (HuGE Navigator)
20626030 compared the subcellular localization and post-translational processing of wild-type (WT)- and retinitis pigmentosa 17 mutant-CAIV in three cell types
20450258 The results suggest that the expression level of carbonic anhydrase IV may be important to maintain retina function in retinitis pigmentosa.
More...

AA Sequence

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRF      1 - 70
FFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMH     71 - 140
IVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPK    141 - 210
EEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRT    211 - 280
VIKSGAPGRPLPWALPALLGPMLACLLAGFLR                                          281 - 312
//

Text Mined References (58)

PMID Year Title
24880201 2014 Carbonic anhydrase 4 and crystallin ?-B immunoreactivity may distinguish benign from malignant thyroid nodules in patients with indeterminate thyroid cytology.
24338019 2014 Intracellular and extracellular carbonic anhydrases cooperate non-enzymatically to enhance activity of monocarboxylate transporters.
24146379 2014 Membrane associated carbonic anhydrase IV (CA IV): a personal and historical perspective.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23297198 2013 GPI-anchored carbonic anhydrase IV displays both intra- and extracellular activity in cRNA-injected oocytes and in mouse neurons.
23049597 2012 Carbonic anhydrases III and IV autoantibodies in rheumatoid arthritis, systemic lupus erythematosus, diabetes, hypertensive renal disease, and heart failure.
22021688 Carbonic anhydrase VI exon 2 genetic polymorphism in Turkish subjects with low caries experience (preliminary study).
21680735 2011 Transport activity of the high-affinity monocarboxylate transporter MCT2 is enhanced by extracellular carbonic anhydrase IV but not by intracellular carbonic anhydrase II.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
More...