Property Summary

NCBI Gene PubMed Count 171
Grant Count 210
R01 Count 120
Funding $18,827,187.96
PubMed Score 735.21
PubTator Score 2018.75

Knowledge Summary

Patent (67,519)

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer -1.400 0.002
hepatocellular carcinoma -1.200 0.000
pancreatic cancer -1.500 0.001
psoriasis 1.600 0.000
osteosarcoma 2.293 0.000
group 4 medulloblastoma -1.600 0.002
Duchenne muscular dystrophy -1.000 0.000
adrenocortical carcinoma -2.177 0.000
primary pancreatic ductal adenocarcinoma 1.106 0.042
non-small cell lung cancer -2.091 0.000
lung cancer -1.500 0.000
cystic fibrosis 1.100 0.002
pediatric high grade glioma -1.100 0.004
atypical teratoid/rhabdoid tumor -1.300 0.000
pancreatic carcinoma -1.500 0.001
lung adenocarcinoma -1.300 0.008
inflammatory breast cancer -4.400 0.000
Bipolar Disorder 1.701 0.039
pituitary cancer -3.000 0.000
chronic rhinosinusitis -1.380 0.024

Synonym

Accession P22736 B4DML7 Q15627 Q53Y00 Q6IBU8
Symbols HMR
N10
TR3
NP10
GFRP1
NAK-1
NGFIB
NUR77

Gene

PDB

2QW4   3V3E   3V3Q   4JGV   4KZI   4KZJ   4KZM   4RE8   4REE   4REF   4RZE   4RZF   4RZG   4WHF   4WHG  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
748 confirmatory 102 / 0 / 96314 High Throughput Fluorescence Polarization Screen for Bcl-B Phenotype Converters
1240 screening 0 / 0 / 49567 Fluorescence Polarization Screen Assay for Bcl-B Phenotype Converters
1243 confirmatory 54 / 0 / 0 Fluorescence Polarization Dose Response Assay for TR3-Based Bcl-B Inhibitors
1244 confirmatory 1 / 0 / 1 Counter Screen for TR3-Based Bcl-B Inhibitors: Fluorescence Polarization Bcl-B/FITC-Bim-BH3 Assay
1245 confirmatory 1 / 0 / 1 Counter Screen for TR3-Based Bcl-B Inhibitors: Fluorescence Polarization Bcl-B/FITC-Puma-BH3 Assay
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (148)

PMID Text
26938745 NR4As regulate gene transcription primarily through interaction with distal enhancers that are co-enriched for NR4A1 and ETS transcription factor motifs
26929200 NR4A1 regulates beta1-integrin expression and beta1-integrin-dependent migration of breast cancer cells, and this is accompanied by decreased expression of beta3-integrin.
26840408 miR-124 to be downregulated in instances of medulloblastoma in which Nur77 is upregulated, resulting in a proliferative state that abets cancer progression.
26768365 The results demonstrate that Nur77 is induced by oxLDL via the p38 MAPK signaling pathway, which is involved in the regulation of cell survival. Nur77 enhanced cell survival via suppressing apoptosis, without affecting cell proliferation of activated macrophages, which may be beneficial in patients with atherosclerosis.
26707825 Studied the expression and function of TR3 in skin. Also studied the function of TR3 in the effect of androgens in keratinocytes by treating HaCaT keratinocytes and primary human keratinocytes with dihydrotestosterone (DHT) and testosterone (T).
26634653 Identified Nur77/Nor1 as novel regulators of thrombomodulin expression and function in vascular endothelial cells.
26564988 The results found that genetic variants of the NUR77 gene are associated with increased risk for both UC and CD
26556724 ApoA-IV colocalizes with NR4A1, which suppresses G6Pase and PEPCK gene expression at the transcriptional level, reducing hepatic glucose output and lowering blood glucose.
26396259 Histone acetylation contributes to the regulation of NR4A1 expression in hypercholesterolaemia, and that NR4A1 expression reduces hypercholesterolaemia-induced inflammation.
26392314 in hepatocytes, HCV core protein increases drug resistance and inhibits cell apoptosis by inhibiting the expressions of NR4A1 and RUNX3
More...

AA Sequence

MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQ      1 - 70
LPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPS     71 - 140
PSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLF    141 - 210
PSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYG    211 - 280
VRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLP    281 - 350
SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW    351 - 420
AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFS    421 - 490
RSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLP    491 - 560
ELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF                                    561 - 598
//

Text Mined References (175)

PMID Year Title
26938745 2016 Genome Wide Mapping of NR4A Binding Reveals Cooperativity with ETS Factors to Promote Epigenetic Activation of Distal Enhancers in Acute Myeloid Leukemia Cells.
26929200 2016 NR4A1 Antagonists Inhibit ?1-Integrin-Dependent Breast Cancer Cell Migration.
26840408 2016 Regulation of Nuclear Receptor Nur77 by miR-124.
26768365 2016 Nur77 inhibits oxLDL induced apoptosis of macrophages via the p38 MAPK signaling pathway.
26707825 2016 TR3 is preferentially expressed by bulge epithelial stem cells in human hair follicles.
26634653 2016 Antithrombotic Effects of Nur77 and Nor1 Are Mediated Through Upregulating Thrombomodulin Expression in Endothelial Cells.
26564988 2016 NUR77 exerts a protective effect against inflammatory bowel disease by negatively regulating the TRAF6/TLR-IL-1R signalling axis.
26556724 2015 Interaction of ApoA-IV with NR4A1 and NR1D1 Represses G6Pase and PEPCK Transcription: Nuclear Receptor-Mediated Downregulation of Hepatic Gluconeogenesis in Mice and a Human Hepatocyte Cell Line.
26396259 2015 Histone acetylation regulates orphan nuclear receptor NR4A1 expression in hypercholesterolaemia.
26392314 2015 HCV core protein promotes hepatocyte proliferation and chemoresistance by inhibiting NR4A1.
More...