Property Summary

NCBI Gene PubMed Count 34
Grant Count 40
R01 Count 34
Funding $3,423,440.36
PubMed Score 187.90
PubTator Score 113.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (19)

PMID Text
25326153 SLC2A5-inhibits the human normal adjacent lung adenocarcinoma cytoplasmic pro-B cell development mechanism network.
23910014 SGLT1 and GLUT5 expression in the plasma membrane is regulated by TNFalpha, leading to alteration on sugar transport, suggesting that TNFalpha could be a physiological local regulator of nutrient absorption in response to an intestinal inflammatory status.
23341889 This study determined if single nucleotide polymorphisms in genes involved in fructose transport,SLC2A2 and SLC2A5 and metabolism, etohexokinase affect inter-individual variability in metabolic phenotypes.
23084044 [(99m)Tc]GLA uptake is related to GLUT-5 transporter expression and transport
21938742 In high grade prostatic intraepithelial neoplasia, Glut-1 was immunohistochemically undetectable and Glut-5 localized to the apical portion of the plasma membrane of the hyper-proliferative cells
21165569 A role for the GLUT5 isoform in fructose uptake that takes place in clear renal cell carcinoma cells and which subsequently leads to the malignant progression.
20965718 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20043883 these results suggest that methylation of histone H3 at K4 and acetylation of histones H3 and H4 are involved in SLC2A5 gene induction associated with intestinal differentiation of Caco-2 cells.
More...

AA Sequence

MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLL      1 - 70
WSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAG     71 - 140
VSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLL    141 - 210
PFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLS    211 - 280
IIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFS    281 - 350
ICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW    351 - 420
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEE    421 - 490
LKELPPVTSEQ                                                               491 - 501
//

Text Mined References (38)

PMID Year Title
26319403 2015 Natural Selection at the Brush-Border: Adaptations to Carbohydrate Diets in Humans and Other Mammals.
25326153 2015 Low glucose transporter SLC2A5-inhibited human normal adjacent lung adenocarcinoma cytoplasmic pro-B cell development mechanism network.
23910014 2013 TNF? regulates sugar transporters in the human intestinal epithelial cell line Caco-2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23341889 2013 Impact of genetic polymorphisms of SLC2A2, SLC2A5, and KHK on metabolic phenotypes in hypertensive individuals.
23084044 2012 Is [(99m)Tc]glucarate uptake mediated by fructose transporter GLUT-5?
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21938742 2012 Cellular distribution of Glut-1 and Glut-5 in benign and malignant human prostate tissue.
21165569 2011 Fructose transporter GLUT5 expression in clear renal cell carcinoma.
More...