Property Summary

NCBI Gene PubMed Count 34
PubMed Score 207.43
PubTator Score 113.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
diabetes mellitus -1.100 3.6e-02
adrenocortical carcinoma -1.424 5.0e-03
astrocytoma 1.900 1.9e-02
Astrocytoma, Pilocytic 1.200 2.5e-04
atypical teratoid / rhabdoid tumor -1.500 1.4e-03
Chronic Lymphocytic Leukemia -1.219 4.4e-04
glioblastoma 2.400 6.2e-03
group 3 medulloblastoma -2.600 6.2e-05
interstitial cystitis 1.400 9.9e-04
lung cancer 1.100 2.4e-03
malignant mesothelioma -2.100 1.3e-05
medulloblastoma, large-cell -2.300 9.1e-05
non-small cell lung cancer 1.155 4.3e-11
osteosarcoma -3.349 5.8e-05
ovarian cancer -3.200 3.6e-12
pediatric high grade glioma 1.300 2.4e-03
primitive neuroectodermal tumor -1.700 3.6e-03
psoriasis 1.200 4.5e-02
tuberculosis -2.000 3.6e-05
Waldenstrons macroglobulinemia -1.096 1.5e-03

Protein-protein Interaction (9)

Gene RIF (19)

AA Sequence

MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLL      1 - 70
WSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAG     71 - 140
VSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLL    141 - 210
PFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLS    211 - 280
IIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFS    281 - 350
ICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW    351 - 420
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEE    421 - 490
LKELPPVTSEQ                                                               491 - 501
//

Text Mined References (38)

PMID Year Title