Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.04
PubTator Score 8.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
breast carcinoma 1.200 4.7e-02
colon cancer -1.100 4.3e-03
ependymoma 1.100 4.9e-02
intraductal papillary-mucinous carcinoma... 1.300 4.1e-04
intraductal papillary-mucinous neoplasm ... 1.600 5.0e-03
juvenile dermatomyositis -1.059 3.0e-05
Multiple myeloma 2.111 1.4e-04
oligodendroglioma 1.100 3.9e-02
osteosarcoma 3.518 4.2e-08
ovarian cancer -1.600 6.0e-04
Pick disease 1.100 1.4e-03
Waldenstrons macroglobulinemia 1.061 1.0e-02

Gene RIF (3)

AA Sequence

MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSR      1 - 70
YEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNV     71 - 140
TTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQ    141 - 210
NHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGS    211 - 280
AEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDV    281 - 350
IKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVA    351 - 420
NADIINAAKKFVSGQKSMAASGNLGHTPFVDEL                                         421 - 453
//

Text Mined References (23)

PMID Year Title