Property Summary

NCBI Gene PubMed Count 56
Grant Count 5
Funding $988,993.43
PubMed Score 20.97
PubTator Score 13.20

Knowledge Summary

Patent (3,567)

Expression

  Differential Expression (28)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.822 0.003
Chronic Lymphocytic Leukemia -2.839 0.000
malignant mesothelioma -1.400 0.000
astrocytoma -2.100 0.003
ependymoma -2.100 0.008
oligodendroglioma -1.400 0.000
cutaneous lupus erythematosus 1.400 0.019
psoriasis -1.300 0.006
glioblastoma -1.700 0.005
osteosarcoma -1.828 0.000
sonic hedgehog group medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.300 0.000
Crohn's disease -1.747 0.006
ulcerative colitis -2.083 0.000
Duchenne muscular dystrophy 1.063 0.000
primary pancreatic ductal adenocarcinoma 1.170 0.006
colon cancer -3.000 0.009
Parkinson's disease -1.700 0.019
sarcoidosis 1.400 0.030
pediatric high grade glioma -1.300 0.000
aldosterone-producing adenoma -1.036 0.042
lung carcinoma 2.000 0.000
Pick disease -1.300 0.014
ovarian cancer -2.600 0.000
Down syndrome 1.200 0.024
pancreatic cancer 1.200 0.005

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

 GWAS Trait (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
504700 screening 273 / 0 / 343427 Fluorescence polarization-based biochemical primary high throughput screening assay to identify activators of the Protein Kinase A-R2B (PKA-R2B) complex
504796 screening 17 / 0 / 253 Counterscreen for activators of the Protein Kinase A-R2B (PKA-R2B) complex: fluorescence polarization-based biochemical high throughput screening assay to identify fluorescence polarization assay artifacts
504797 screening 25 / 0 / 245 Fluorescence polarization-based biochemical high throughput confirmation assay for activators of the Protein Kinase A-R2B (PKA-R2B) complex
504888 confirmatory 7 / 0 / 4 Fluorescence polarization-based biochemical high throughput dose response assay for activators of the Protein Kinase A-R2B (PKA-R2B) complex
504893 confirmatory 7 / 0 / 1 Counterscreen for activators of the Protein Kinase A-R1A (PKA-R1A) complex: fluorescence polarization-based biochemical high throughput dose response assay to identify activators of the Protein Kinase A-R2B (PKA-R2B) complex

Gene RIF (43)

PMID Text
25831493 analysis of the mechanism underlying synergistic up-regulation of PDE4B2 via a cross-talk between PKA-Cbeta and p65
24294386 The gene polymorphism loci rs12132032 in PRKACB maybe a potential risk factor for anencephaly in Chinese population from Shanxi, while gender susceptibility may influence the correlation.
24189052 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
22114277 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21745501 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21651489 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21651489 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20564261 The previously unknown small molecule inhibitor-dependent interaction of Cbeta1 with the cell cycle and apoptosis regulatory protein-1 was verified.
20433920 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20402410 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
More...

AA Sequence

MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYY      1 - 70
AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFS     71 - 140
EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI    141 - 210
ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK    211 - 280
RFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGE    281 - 350
F//

Text Mined References (62)

PMID Year Title
25831493 2015 Cross-talk between PKA-C? and p65 mediates synergistic induction of PDE4B by roflumilast and NTHi.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24294386 2013 Association between PKA gene polymorphism and NTDs in high risk Chinese population in Shanxi.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23001122 2012 Genome-wide association study identifies a common variant in RAD51B associated with male breast cancer risk.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
More...