Property Summary

Ligand Count 2
NCBI Gene PubMed Count 56
PubMed Score 23.61
PubTator Score 13.20

Knowledge Summary

Patent (3,567)

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma -1.300 6.8e-06
aldosterone-producing adenoma -1.036 4.2e-02
astrocytic glioma -1.400 1.3e-02
atypical teratoid / rhabdoid tumor -2.100 2.0e-06
Chronic Lymphocytic Leukemia -2.839 6.7e-06
colon cancer -2.000 5.7e-03
Crohn's disease -1.747 5.7e-03
cutaneous lupus erythematosus 1.400 1.9e-02
Down syndrome 1.200 2.4e-02
Duchenne muscular dystrophy 1.063 2.7e-07
ependymoma -2.100 7.6e-03
glioblastoma -1.300 1.5e-07
lung carcinoma 2.000 1.8e-27
malignant mesothelioma -1.400 2.0e-05
medulloblastoma -1.100 3.2e-07
medulloblastoma, large-cell -2.500 2.1e-06
oligodendroglioma -1.200 4.6e-02
osteosarcoma 1.095 5.5e-03
ovarian cancer -2.600 6.7e-11
pancreatic cancer 1.200 5.1e-03
Parkinson's disease -1.700 1.9e-02
Pick disease -1.300 1.4e-02
primary pancreatic ductal adenocarcinoma 1.170 5.8e-03
primitive neuroectodermal tumor -1.300 2.8e-04
psoriasis -1.300 6.2e-03
sarcoidosis 1.200 2.7e-02
ulcerative colitis -2.083 3.7e-04
Waldenstrons macroglobulinemia 1.822 2.8e-03

 GWAS Trait (1)

Gene RIF (42)

AA Sequence

MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYY      1 - 70
AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFS     71 - 140
EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI    141 - 210
ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK    211 - 280
RFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGE    281 - 350
F//

Text Mined References (62)

PMID Year Title