Property Summary

NCBI Gene PubMed Count 80
Grant Count 97
R01 Count 84
Funding $6,748,889.1
PubMed Score 283.67
PubTator Score 210.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P22692 A0N9W2 B4E351 Q5U012 Q9UCL6 IBP-4
Symbols BP-4
IBP4
IGFBP-4
HT29-IGFBP

Gene

PDB

1WQJ   2DSP   2DSQ   2DSR  

Gene RIF (47)

PMID Text
27019456 Data show that insulin-like growth factor binding protein-4 (IGFBP-4) was significantly elevated in lupus nephritis, particularly those with renal pathology chronicity changes.
26195635 Data show that co-transfection with cDNA encoding stanniocalcin-1 abrogates the proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) toward IGF-binding protein 4 (IGFBP-4).
26135353 The present study provides the first evidence that apoptosis inhibitor of macrophages binds to IGFBP2, 3 and 4.
26046968 High IGFBP-4 fragment levels were associated with increased all-cause and cardiovascular mortality rates in T1D patients with and without diabetic nephropathy.
25489725 PLasma IGFBP-4 levels are not acutely altered following myocardial infarction treated with heparin and percutaneous coronary intervention.
25475528 Data indicate co-localization of insulin-like growth factor binding proteins IGFBP-4, IGFBP-5 in the syncytiotrophoblast layer of first trimester placental villi as early as 5 weeks of gestational age.
24778188 IGF-1/IGFbp4 signaling regulated the post-developmental adipose tissue expansion.
24201068 Despite the relation of CT-IGFBP4 to a more severe coronary artery disease, CT- and NT-IGFBP4, in contrast to our report based on total PAPP-A, failed to predict any long-term outcomes in patients with stable cardiovascular disease.
24060054 PAPP-A and IGFBP-4 gene expression (microarray analysis) was significantly upregulated in IL-1beta- or TNF-alpha-exposed cells.
23975422 these findings demonstrate an oncogenic property for IBP in promoting the metastatic potential of breast cancer cells.
More...

AA Sequence

MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY      1 - 70
TPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQ     71 - 140
KHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNF    141 - 210
HPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE                          211 - 258
//

Text Mined References (87)

PMID Year Title
27019456 2016 Insulin-Like Growth Factor Binding Protein-4 as a Marker of Chronic Lupus Nephritis.
26195635 2015 Stanniocalcin-1 Potently Inhibits the Proteolytic Activity of the Metalloproteinase Pregnancy-associated Plasma Protein-A.
26135353 2015 Interaction of AIM with insulin-like growth factor-binding protein-4.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26046968 2015 IGFBP-4 Fragments as Markers of Cardiovascular Mortality in Type 1 Diabetes Patients With and Without Nephropathy.
25489725 2015 PAPP-A and IGFBP-4 fragment levels in patients with ST-elevation myocardial infarction treated with heparin and PCI.
25475528 2014 IGFBP-4 and -5 are expressed in first-trimester villi and differentially regulate the migration of HTR-8/SVneo cells.
24778188 2014 Control of adipose tissue expandability in response to high fat diet by the insulin-like growth factor-binding protein-4.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...