Property Summary

NCBI Gene PubMed Count 343
PubMed Score 328.54
PubTator Score 707.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cancer 2499 4.337 2.2
Disease Target Count
Juvenile Myelomonocytic Leukemia 21

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 6.3e-06
glioblastoma 1.500 1.4e-05
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
medulloblastoma, large-cell 1.100 2.2e-04
osteosarcoma 1.241 1.9e-03
ovarian cancer 1.200 2.2e-06
pediatric high grade glioma 1.100 3.2e-05
Pick disease 1.500 1.2e-07
primary Sjogren syndrome 1.200 4.6e-03
primitive neuroectodermal tumor 1.300 1.1e-03
Rheumatoid arthritis 2.100 7.0e-04
ulcerative colitis 1.300 6.3e-06

Protein-protein Interaction (1)

Gene RIF (200)

AA Sequence

MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLC      1 - 70
QNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERM     71 - 140
YEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALH    141 - 210
EVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKAR    211 - 280
LQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLT    281 - 350
GLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR    351 - 420
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVERPPSPFSMAPQ    421 - 490
ASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRP    491 - 560
QRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVSAPSSSDPWTGRELTNRHSLPFSLPSQMEP    561 - 630
RPDVPRLGSTFSLDTSMSMNSSPLVGPECDHPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEY    631 - 700
MTPSSRPLRPLDTSQSSRACDCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENE    701 - 770
DDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC    771 - 840
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVAT        841 - 906
//

Text Mined References (363)

PMID Year Title