Property Summary

NCBI Gene PubMed Count 333
Grant Count 513
R01 Count 357
Funding $42,987,398.05
PubMed Score 849.95
PubTator Score 707.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession P22681 A3KMP8
Symbols CBL2
NSLL
C-CBL
RNF55
FRA11B

Gene

CBL

PANTHER Protein Class (1)

PDB

3BUM   3OB1   4A49   4A4B   4A4C   3BUO   3OB2   3BUX   1FBV   1B47   1YVH   2CBL   2JUJ   2K4D   2OO9   2Y1M   2Y1N   3BUN   3BUW   3PLF   4GPL   5J3X  

 GWAS Trait (1)

Gene RIF (192)

PMID Text
26474280 Data suggest that the combination of peritumoral Cbl and EGFR serves as a much stronger indicator to make an accurate prognosis, especially during early recurrence.
26449661 The study reveals a role of CBL in restricting myeloid proliferation of human AML1-ETOinduced leukemia, and identifies UBASH3B as a potential target for pharmaceutical intervention.
26353930 H19 non coding RNA-derived miR-675 enhances tumorigenesis and metastasis of breast cancer cells by downregulating c-Cbl and Cbl-b.
26142735 The result indicated that TMZ may overcome TRAIL resistance in GSCs by suppressing c-FLIP expression through c-Cbl-mediated ubiquitination and degradation
26055326 Overexpression of Smad7 in human HaCaT keratinocyte cells and mouse skin tissues elevated EGF receptor (EGFR) activity by impairing ligand-induced ubiquitination and degradation of activated receptor, which is induced by the E3 ubiquitin ligase c-Cbl.
25965880 Demonstrate role for CBL in the control of AXL/SYK/LYN network mediating resistance to nilotinib treatment in chronic myeloid leukemia cells.
25952305 Genotype-phenotype correlation analysis performed on available records indicated that germline CBL mutations cause a variable phenotype characterized by a relatively high frequency of neurological features, predisposition to diseases.
25939664 The penetrance of the CBL Y371C mutation was 30% for JMML and 40% for all leukemia.
25784557 novel mechanism for the regulation of active nuclear beta-catenin by c-Cbl and its critical role in angiogenesis.
25521828 Erbin promotes tumourigenesis and tumour growth in colorectal cancer by stabilizing epidermal growth factor receptor
More...

AA Sequence

MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLC      1 - 70
QNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERM     71 - 140
YEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALH    141 - 210
EVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKAR    211 - 280
LQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLT    281 - 350
GLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR    351 - 420
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVERPPSPFSMAPQ    421 - 490
ASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRP    491 - 560
QRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVSAPSSSDPWTGRELTNRHSLPFSLPSQMEP    561 - 630
RPDVPRLGSTFSLDTSMSMNSSPLVGPECDHPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEY    631 - 700
MTPSSRPLRPLDTSQSSRACDCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENE    701 - 770
DDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC    771 - 840
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVAT        841 - 906
//

Text Mined References (353)

PMID Year Title
27059931 2016 Weak binding to E3 ubiquitin ligase c-Cbl increases EGFRvA protein stability.
26474280 2015 Peritumoral Cbl is a strong independent prognostic marker after curative resection of hepatocellular carcinoma.
26449661 2016 UBASH3B/Sts-1-CBL axis regulates myeloid proliferation in human preleukemia induced by AML1-ETO.
26353930 2015 H19 non coding RNA-derived miR-675 enhances tumorigenesis and metastasis of breast cancer cells by downregulating c-Cbl and Cbl-b.
26142735 2015 Temozolomide sensitizes stem-like cells of glioma spheres to TRAIL-induced apoptosis via upregulation of casitas B-lineage lymphoma (c-Cbl) protein.
26055326 2015 Smad7 Modulates Epidermal Growth Factor Receptor Turnover through Sequestration of c-Cbl.
25965880 2015 CBL controls a tyrosine kinase network involving AXL, SYK and LYN in nilotinib-resistant chronic myeloid leukaemia.
25952305 2015 Molecular Diversity and Associated Phenotypic Spectrum of Germline CBL Mutations.
25939664 2015 Juvenile myelomonocytic leukemia due to a germline CBL Y371C mutation: 35-year follow-up of a large family.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
More...