Property Summary

NCBI Gene PubMed Count 106
Grant Count 133
R01 Count 103
Funding $12,139,335.32
PubMed Score 466.54
PubTator Score 359.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P22680 P78454 Q3MIL8 Q7KZ19
Symbols CP7A
CYP7
CYPVII

Gene

PANTHER Protein Class (2)

PDB

3DAX   3SN5   3V8D  

Gene RIF (103)

PMID Text
26345803 Macrophage cholesterol efflux in patients with type II diabetes mellitus was significantly reduced, and that this reduction was associated with the down-regulation of CYP7A1 expression.
26333513 CYP7A1 and APOE isoform are associated with the extent of reduction in circulating LDL cholesterol in response to plant sterols consumption.
25944972 The CYP7A1 rs7833904 polymorphism may modify the risk of CAD.
25499945 genetic polymorphism is associated with the total cholesterol level and the lipid-lowering efficacy of statin treatment. [meta-analysis]
25360185 we identified for the first time a significant association of the A-204C polymorphism of the CYP7A1 gene and development of tuberculosis in a Moroccan population
25103562 The CYP7A1 -204A>C polymorphism is significantly associated with serum lipid levels in Asian population, but not gallbladder stone disease. [Meta-analysis]
24927729 The CYP7A1 crystallographic models identify residues involved in cholest-4-en-3-one binding.
24582860 Cyp7a1 is a direct Thyroid hormone receptor (TR) target gene that responds to physiologic TR levels through a set of distinct response elements in its promoter.
24365583 Activation of the VDR represses hepatic SHP to increase levels of CYP7A1 and reduce cholesterol.
23740208 Two known single nucleotide polymorphisms were identified in the 5'-UTR of CYP7A1 and both were associated with neuromyelitis optica but not with Multiple sclerosis.
More...

AA Sequence

MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQRKHGHVFTCK      1 - 70
LMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALNS     71 - 140
LTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMFEAGYLTIFGRDLTRRDTQKAHILNNLDNFK    141 - 210
QFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHL    211 - 280
VVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSII    281 - 350
KESLRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK    351 - 420
TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILP    421 - 490
PLNDIEFKYKFKHL                                                            491 - 504
//

Text Mined References (106)

PMID Year Title
26345803 2015 Correlation between the decrease of cholesterol efflux from macrophages in patients with type II diabetes mellitus and down-regulated CYP7A1 expression.
26333513 2015 CYP7A1-rs3808607 and APOE isoform associate with LDL cholesterol lowering after plant sterol consumption in a randomized clinical trial.
25944972 2015 CYP7A1 gene polymorphism located in the 5' upstream region modifies the risk of coronary artery disease.
25499945 The role of common variants of ABCB1 and CYP7A1 genes in serum lipid levels and lipid-lowering efficacy of statin treatment: a meta-analysis.
25360185 2014 The CYP7A1 gene rs3808607 variant is associated with susceptibility of tuberculosis in Moroccan population.
25103562 2014 Relationship between CYP7A1 -204A>C polymorphism with gallbladder stone disease and serum lipid levels: a meta-analysis.
24927729 2014 Structural characterization of human cholesterol 7?-hydroxylase.
24582860 2014 Thyroid hormone induction of human cholesterol 7 alpha-hydroxylase (Cyp7a1) in vitro.
24365583 2014 Vitamin D receptor activation down-regulates the small heterodimer partner and increases CYP7A1 to lower cholesterol.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...