Property Summary

NCBI Gene PubMed Count 76
Grant Count 115
R01 Count 76
Funding $11,193,943.84
PubMed Score 1273.33
PubTator Score 78.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P22676 A8K4Y1 Q53HD2 Q96BK4 CR
Symbols CR
CAL2
CAB29

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (56)

PMID Text
26695618 Overexpression of human calretinin in mouse primary mesothelial cells inversely affects proliferation and cell migration.
26417681 Age-related loss of CB appears to coincide with tangle formation in the BFCN and is associated with the full range of tau pathology, including late appearing epitopes.
26230373 Patients with Down syndrome may have enteric nervous system disorders functionally similar to HD, related to abnormal or imbalanced autonomic innervation, of which distal calretinin hypoinnervation is one manifestation, despite the presence of ganglia.
26081613 In focal cortical dysplasia (FCD), the density of CR positive neurons was increased in cortical layer V compared to non-FCD temporal lobe.
25620022 the unique disposition of CALR at the MII spindle uncovers a physical interaction with endoplasmic reticulum that may mediate cytoskeletal remodelling during oocyte maturation.
25119007 Calretinin positivity was observed in all rectal biopsies of Hirschsprung disease showing the presence of ganglion cells, and the staining was consistently absent in all cases of aganglionosis.
25046230 might be used as a marker for the ameloblastomas and could play an important role in the differentiation of aggressiveness of different odontogenic tumors
24323466 We concluded that WT1, but not calretinin, is a useful prognostic factor in malignant pleural mesothelioma
24322014 calretinin immunoexpression and the hormonal status for estrogen receptors (ER), progesterone receptors (PR), and ERRB2, in 33 cases of cutaneous metastases of ductal breast carcinoma, as well as in seven primary cutaneous apocrine tumors, were studied
24294384 Calretinin IHC offered additional diagnostic value in the Hirschprung disease using specimens with inadequate amount of submucosa and rarely seen ganglion cells.
More...

AA Sequence

MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKE      1 - 70
FMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLL     71 - 140
KKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKD    141 - 210
RSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM             211 - 271
//

Text Mined References (77)

PMID Year Title
26695618 2015 Overexpression or absence of calretinin in mouse primary mesothelial cells inversely affects proliferation and cell migration.
26417681 2015 Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.
26230373 Calretinin-Immunoreactive Hypoinnervation in Down Syndrome (DS): Report of an Infant with Very Short-Segment Hirschsprung Disease and Comparison to Biopsy Findings in 20 Normal Infants and 11 Infants with DS and Chronic Constipation.
26081613 2015 Calcium-binding proteins in focal cortical dysplasia.
25620022 2015 Expression and intracytoplasmic distribution of staufen and calreticulin in maturing human oocytes.
25119007 2014 Evaluation of calretinin immunohistochemistry as an additional tool in confirming the diagnosis of Hirschsprung disease.
25046230 Immunohistochemical expression of calretinin in ameloblastoma, adenomatoid odontogenic tumor, and keratocystic odontogenic tumor: a comparative study.
24323466 2014 Expression of Wilms' tumor gene (WT1) is associated with survival in malignant pleural mesothelioma.
24322014 2013 Cutaneous metastases from breast carcinoma: calretinin expression and estrogen, progesterone and Her2/neu status of the metastases, compared to primary cutaneous apocrine tumors.
24294384 2013 Role of calretinin immunohistochemical stain in evaluation of Hirschsprung disease: an institutional experience.
More...