Property Summary

NCBI Gene PubMed Count 81
PubMed Score 1330.59
PubTator Score 78.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -5.800 1.4e-09
adult high grade glioma -2.400 2.0e-04
aldosterone-producing adenoma -1.242 2.1e-02
astrocytic glioma -1.300 4.6e-03
Astrocytoma, Pilocytic -1.500 1.3e-03
atypical teratoid/rhabdoid tumor -1.400 8.8e-04
ductal carcinoma in situ -3.200 8.2e-04
ependymoma -1.500 1.4e-03
glioblastoma -2.500 2.2e-09
group 3 medulloblastoma -1.700 2.7e-02
invasive ductal carcinoma -3.900 8.4e-04
oligodendroglioma -1.500 1.3e-02
ovarian cancer -4.500 3.5e-23
primitive neuroectodermal tumor -1.900 4.3e-03

Synonym

Accession P22676 A8K4Y1 Q53HD2 Q96BK4 CR
Symbols CR
CAL2
CAB29

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (61)

AA Sequence

MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKE      1 - 70
FMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLL     71 - 140
KKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKD    141 - 210
RSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM             211 - 271
//

Text Mined References (82)

PMID Year Title