Property Summary

NCBI Gene PubMed Count 11
PubMed Score 37.40
PubTator Score 324.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.308 4.0e-03
active ulcerative colitis 1.411 9.7e-03
breast carcinoma 1.800 1.5e-04
cutaneous lupus erythematosus -1.300 5.0e-02
group 3 medulloblastoma -1.100 4.5e-03
interstitial cystitis -1.400 1.1e-03
lung adenocarcinoma 1.700 6.6e-06
malignant mesothelioma 2.100 8.7e-08
non primary Sjogren syndrome sicca 1.400 1.5e-02
non-small cell lung cancer 1.012 6.6e-13
pituitary cancer -1.900 5.1e-10
primitive neuroectodermal tumor -1.200 2.8e-03
psoriasis -1.200 5.3e-04

Gene RIF (5)

AA Sequence

MVTPCPTSPSSPAARAGRRDNDQNLRAPVKKSRRPRLRRKQPLHPLNPCPLPGDSGICDLFESPSSGSDG      1 - 70
AESPSAARGGSPLPGPAQPVAQLDLQTFRDYGQSCYAFRKAQESHFHPREALARQPQVTAESRCKLLSWL     71 - 140
IPVHRQFGLSFESLCLTVNTLDRFLTTTPVAADCFQLLGVTSLLIACKQVEVHPPRVKQLLALCCGAFSR    141 - 210
QQLCNLECIVLHKLHFTLGAPTISFFLEHFTHARVEAGQAEASEALEAQALARGVAELSLADYAFTSYSP    211 - 280
SLLAICCLALADRMLRVSRPVDLRLGDHPEAALEDCMGKLQLLVAINSTSLTHMLPVQICEKCSLPPSSK    281 - 350
//

Text Mined References (14)

PMID Year Title