Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $374,539.99
PubMed Score 34.05
PubTator Score 324.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (3)

PMID Text
24747639 CCNO mutations have a role in congenital mucociliary clearance disorder with reduced generation of multiple motile cilia
8419333 This publication corrected the mistaken attribution of uracil DNA glycosylase activity to this gene.
2001396 This publication initially attributed 'uracil-DNA glycosylase' activity to this gene and named it UNG2, but a later publication (PubMed ID: 8419333) more correctly identified UNG2/CCNO as a member of the cyclin protein family.

AA Sequence

MVTPCPTSPSSPAARAGRRDNDQNLRAPVKKSRRPRLRRKQPLHPLNPCPLPGDSGICDLFESPSSGSDG      1 - 70
AESPSAARGGSPLPGPAQPVAQLDLQTFRDYGQSCYAFRKAQESHFHPREALARQPQVTAESRCKLLSWL     71 - 140
IPVHRQFGLSFESLCLTVNTLDRFLTTTPVAADCFQLLGVTSLLIACKQVEVHPPRVKQLLALCCGAFSR    141 - 210
QQLCNLECIVLHKLHFTLGAPTISFFLEHFTHARVEAGQAEASEALEAQALARGVAELSLADYAFTSYSP    211 - 280
SLLAICCLALADRMLRVSRPVDLRLGDHPEAALEDCMGKLQLLVAINSTSLTHMLPVQICEKCSLPPSSK    281 - 350
//

Text Mined References (12)

PMID Year Title
24824133 2015 Unexpected genetic heterogeneity for primary ciliary dyskinesia in the Irish Traveller population.
24747639 2014 Mutations in CCNO result in congenital mucociliary clearance disorder with reduced generation of multiple motile cilia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
16697536 2006 The cyclin-like uracil DNA glycosylase (UDG) of murine oocytes and its relationship to human and chimpanzee homologues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...