Property Summary

NCBI Gene PubMed Count 9
PubMed Score 34.05
PubTator Score 324.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 6.61137773425892E-13
pituitary cancer 1972 5.05603404023907E-10
malignant mesothelioma 3163 8.6520836460719E-8
lung adenocarcinoma 2714 6.62848875471193E-6
interstitial cystitis 2299 3.19668051222992E-5
breast carcinoma 1614 1.53970432949863E-4
psoriasis 6685 5.34853347720361E-4
primitive neuroectodermal tumor 3031 0.00277064137942546
active Crohn's disease 918 0.00396904721155819
group 3 medulloblastoma 2254 0.00452423349683842
active ulcerative colitis 477 0.00972907062192021
non primary Sjogren syndrome sicca 840 0.0145203546211429
cutaneous lupus erythematosus 1056 0.0496774123749139
Disease Target Count Z-score Confidence
Hydrocephalus 60 3.11 1.6

Expression

  Differential Expression (13)

Synonym

Accession P22674 A8K1W5 Q0P6J2 Q9H6B0 Q9UMD5
Symbols CCNU
UDG2
CILD29

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
24747639 CCNO mutations have a role in congenital mucociliary clearance disorder with reduced generation of multiple motile cilia
8419333 This publication corrected the mistaken attribution of uracil DNA glycosylase activity to this gene.
2001396 This publication initially attributed 'uracil-DNA glycosylase' activity to this gene and named it UNG2, but a later publication (PubMed ID: 8419333) more correctly identified UNG2/CCNO as a member of the cyclin protein family.

AA Sequence

MVTPCPTSPSSPAARAGRRDNDQNLRAPVKKSRRPRLRRKQPLHPLNPCPLPGDSGICDLFESPSSGSDG      1 - 70
AESPSAARGGSPLPGPAQPVAQLDLQTFRDYGQSCYAFRKAQESHFHPREALARQPQVTAESRCKLLSWL     71 - 140
IPVHRQFGLSFESLCLTVNTLDRFLTTTPVAADCFQLLGVTSLLIACKQVEVHPPRVKQLLALCCGAFSR    141 - 210
QQLCNLECIVLHKLHFTLGAPTISFFLEHFTHARVEAGQAEASEALEAQALARGVAELSLADYAFTSYSP    211 - 280
SLLAICCLALADRMLRVSRPVDLRLGDHPEAALEDCMGKLQLLVAINSTSLTHMLPVQICEKCSLPPSSK    281 - 350
//

Text Mined References (12)

PMID Year Title
24824133 2015 Unexpected genetic heterogeneity for primary ciliary dyskinesia in the Irish Traveller population.
24747639 2014 Mutations in CCNO result in congenital mucociliary clearance disorder with reduced generation of multiple motile cilia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
16697536 2006 The cyclin-like uracil DNA glycosylase (UDG) of murine oocytes and its relationship to human and chimpanzee homologues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...