Property Summary

NCBI Gene PubMed Count 45
Grant Count 67
R01 Count 40
Funding $4,882,495.18
PubMed Score 292.69
PubTator Score 125.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.300 0.000
osteosarcoma -2.208 0.000

Synonym

Accession P22670
Symbols EFC
RFX

Gene

PANTHER Protein Class (1)

PDB

1DP7  

Gene RIF (22)

PMID Text
25979195 therapeutic targets for childhood severe asthmatics identified thru DNA microarray
24952874 Data indicate that regulatory factor X transcription factor RFX-1 regulates SC-2001-mediated SHP-1 Phosphatase transcription in hepatocellular carcinoma cells.
24526308 regulatory factor 1 directly regulates CD44 expression in glioblastoma
22582395 RFX1 reduces cell proliferation through inhibiting the TGFbeta2-ERK signaling pathway. RFX1 blocks TGFbeta2 expression through its direct action on TGFbeta2 transcription.
22490869 NLRC5-mediated histocompatibiility class I gene induction requires the W/S and X1, X2 cis-regulatory elements.
22415835 Taken together, this study suggests ciliogenic RFX transcription factors regulate FGF-1B promoter activity and the maintenance of F1BGFP(+) NSPCs and GBM-SCs.
21719561 in serum- or IGF-1-stimulated breast cancer MCF-7 cells, JNK induces SHP1 expression through the binding of AP-4 and RFX-1 transcription factors to the epithelial tissue-specific SHP1 promoter.
21192791 RFX1 recruits SUV39H1 to the promoter regions of the CD11a and CD70 genes in CD4(+) T cells, thereby regulating local H3K9 tri-methylation levels.
20381594 We show binding of RFX proteins to an evolutionarily conserved X-box in the ALMS1 proximal promoter and present evidence that these proteins are responsible for ALMS1 transc
20223637 regulates autoimmunity via epigenetic modifications in T cells of systemic lupus erythematosus patients
More...

AA Sequence

MATQAYTELQAAPPPSQPPQAPPQAQPQPPPPPPPAAPQPPQPPTAAATPQPQYVTELQSPQPQAQPPGG      1 - 70
QKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQG     71 - 140
TQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQQVHSPPEQSP    141 - 210
VQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQ    211 - 280
QLQQVPVPHVYSSQVQYVEGGDASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAV    281 - 350
ASSGSMPMYVSGSQVVASSTSTGAGASNSSGGGGSGGGGGGGGGGGGGGSGSTGGGGSGAGTYVIQGGYM    351 - 420
LGSASQSYSHTTRASPATVQWLLDNYETAEGVSLPRSTLYCHYLLHCQEQKLEPVNAASFGKLIRSVFMG    421 - 490
LRTRRLGTRGNSKYHYYGLRIKASSPLLRLMEDQQHMAMRGQPFSQKQRLKPIQKMEGMTNGVAVGQQPS    491 - 560
TGLSDISAQVQQYQQFLDASRSLPDFTELDLQGKVLPEGVGPGDIKAFQVLYREHCEAIVDVMVNLQFTL    561 - 630
VETLWKTFWRYNLSQPSEAPPLAVHDEAEKRLPKAILVLLSKFEPVLQWTKHCDNVLYQGLVEILIPDVL    631 - 700
RPIPSALTQAIRNFAKSLESWLTHAMVNIPEEMLRVKVAAAGAFAQTLRRYTSLNHLAQAARAVLQNTAQ    701 - 770
INQMLSDLNRVDFANVQEQASWVCRCEDRVVQRLEQDFKVTLQQQNSLEQWAAWLDGVVSQVLKPYQGSA    771 - 840
GFPKAAKLFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMYYLIEHRVAQAKGETPIAVMGEFA    841 - 910
NLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS     911 - 979
//

Text Mined References (53)

PMID Year Title
27283392 2016 Transcription factor RFX1 is ubiquitinated by E3 ligase STUB1 in systemic lupus erythematosus.
25979195 Identification of therapeutic targets for childhood severe asthmatics with DNA microarray.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24952874 2014 RFX1-dependent activation of SHP-1 induces autophagy by a novel obatoclax derivative in hepatocellular carcinoma cells.
24526308 2014 Regulatory factor X1 is a new tumor suppressive transcription factor that acts via direct downregulation of CD44 in glioblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22582395 2012 Regulatory factor X1-induced down-regulation of transforming growth factor ?2 transcription in human neuroblastoma cells.
22490869 2012 NLRC5 cooperates with the RFX transcription factor complex to induce MHC class I gene expression.
22415835 2012 Ciliogenic RFX transcription factors regulate FGF1 gene promoter.
More...