Property Summary

NCBI Gene PubMed Count 107
PubMed Score 195.36
PubTator Score 176.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Adult T-Cell Lymphoma/Leukemia 30
Disease Target Count P-value
glioblastoma multiforme 347 4.13075627443026E-23
ovarian cancer 8492 8.1676453639493E-9
juvenile dermatomyositis 1189 7.99446569510159E-8
Pick disease 1893 3.8178432997423E-7
atypical teratoid / rhabdoid tumor 4369 1.59849494187512E-5
adult high grade glioma 2148 2.06460579854773E-4
acute quadriplegic myopathy 1157 2.7098007220392E-4
Multiple myeloma 1328 2.89821540534566E-4
ependymoma 2514 9.84226808883389E-4
Waldenstrons macroglobulinemia 765 0.00133139665441034
primary pancreatic ductal adenocarcinoma 1271 0.00249531330040643
Polycystic Ovary Syndrome 335 0.00325002579258932
group 3 medulloblastoma 2254 0.00344907657194767
progressive supranuclear palsy 674 0.00367222568265501
pancreatic cancer 2300 0.00462687304316656
astrocytic glioma 2241 0.00551269492243574
medulloblastoma, large-cell 6234 0.00609055279334696
primitive neuroectodermal tumor 3031 0.00685564589231734
oligodendroglioma 2849 0.0126161820630539
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0316702199905194
Disease Target Count Z-score Confidence
Cancer 2346 3.741 1.9
Amyotrophic Lateral Sclerosis 432 3.502 1.8

Expression

Synonym

Accession P22626 A0A024RA27 A0A024RA61 A8K064 P22627 Q9UC98 Q9UDJ2 hnRNP A2/B1
Symbols RNPA2
HNRPA2
HNRPB1
SNRPB1
HNRNPA2
HNRNPB1
IBMPFD2
HNRPA2B1

Gene

PDB

1X4B  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (74)

PMID Text
26805816 hnRNPA2B1, hnRNPD, hnRNPL , and YBX1 might play important roles in gastric cancer tumorigenesis.
26321680 Study finds that the RNA-binding protein HNRNPA2B1 binds m(6)A-bearing RNAs in vivo and in vitro and its biochemical footprint matches the m(6)A consensus motif. HNRNPA2B1 directly binds a set of nuclear transcripts and elicits similar alternative splicing effects as the m(6)A writer METTL3.
26176628 A unique role of the embryonic miR-369-HNRNPA2B1 axis in controlling metabolic enzyme function.
26011126 lowering the levels of hnRNP A1/A2 elicits defective transcription elongation on a fraction of P-TEFb-dependent genes, hence favoring the transcription of P-TEFb-independent genes
25483567 Tissue analysis and knockdown of hnRNPA2B1 using siRNA subsequently demonstrated both the overexpression and potential role for this molecule in lung tumorigenesis.
25378556 Nuclear TDP-43 becomes neurotoxic by escaping from the inhibitory regulation by hnRNP-U or hnRNP-A2.
25169827 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
25124043 data suggest that a prominent down-regulation of hnRNP-A2/B1 during hypoxia is associated with the post-transcriptional suppression of hASH1 synthesis.
24998203 In KRAS-dependent pancreatic ductal adenocarcinoma cell lines, HNRNPA2B1 interacts with and regulates the activity of KRAS G12V and G12D.
24920338 TDP-43 suppresses CGG-mediated toxicity through interactions with hnRNP A2/B1 and suggest a convergence of pathogenic cascades between repeat expansion disorders and RNA-binding proteins implicated in neurodegenerative disease.
More...

AA Sequence

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFS      1 - 70
SMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDT     71 - 140
IEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFG    141 - 210
DSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQG    211 - 280
GGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGR    281 - 350
SRY                                                                       351 - 353
//

Text Mined References (133)

PMID Year Title
26805816 2016 Unraveling Molecular Differences of Gastric Cancer by Label-Free Quantitative Proteomics Analysis.
26544936 2015 The LC Domain of hnRNPA2 Adopts Similar Conformations in Hydrogel Polymers, Liquid-like Droplets, and Nuclei.
26321680 2015 HNRNPA2B1 Is a Mediator of m(6)A-Dependent Nuclear RNA Processing Events.
26176628 2015 Embryonic MicroRNA-369 Controls Metabolic Splicing Factors and Urges Cellular Reprograming.
26011126 2015 A Function for the hnRNP A1/A2 Proteins in Transcription Elongation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25483567 2015 Abnormal levels of heterogeneous nuclear ribonucleoprotein A2B1 (hnRNPA2B1) in tumour tissue and blood samples from patients diagnosed with lung cancer.
25378556 2015 Nuclear TDP-43 causes neuronal toxicity by escaping from the inhibitory regulation by hnRNPs.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
More...