Property Summary

NCBI Gene PubMed Count 120
PubMed Score 210.33
PubTator Score 176.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 437 3.974 2.0
Cancer 2388 3.767 1.9

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.149 2.7e-04
adult high grade glioma -1.200 2.1e-04
astrocytic glioma 2.500 5.5e-03
atypical teratoid / rhabdoid tumor -1.100 1.6e-05
ependymoma 2.800 9.8e-04
glioblastoma -1.100 4.0e-04
group 3 medulloblastoma 1.800 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-02
juvenile dermatomyositis 1.002 8.0e-08
medulloblastoma, large-cell -1.100 6.1e-03
Multiple myeloma 1.951 2.9e-04
oligodendroglioma 2.300 1.3e-02
ovarian cancer -2.700 8.2e-09
pancreatic cancer 1.400 4.6e-03
Pick disease -3.100 9.0e-08
Polycystic ovary syndrome 1.753 3.3e-03
primary pancreatic ductal adenocarcinoma 1.076 1.1e-02
primitive neuroectodermal tumor 1.300 6.9e-03
progressive supranuclear palsy -2.800 3.7e-03
Waldenstrons macroglobulinemia 2.094 1.3e-03

Gene RIF (85)

AA Sequence

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFS      1 - 70
SMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDT     71 - 140
IEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFG    141 - 210
DSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQG    211 - 280
GGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGR    281 - 350
SRY                                                                       351 - 353
//

Text Mined References (147)

PMID Year Title