Property Summary

NCBI Gene PubMed Count 27
PubMed Score 4.71
PubTator Score 6.27

Knowledge Summary

Patent (775)

TINX Plot

Expression

 GWAS Trait (1)

Gene RIF (27)

AA Sequence

MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHY      1 - 70
AMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFS     71 - 140
EPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEI    141 - 210
ILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTK    211 - 280
RFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSE    281 - 350
F//

Text Mined References (29)

PMID Year Title