Property Summary

NCBI Gene PubMed Count 27
PubMed Score 4.73
PubTator Score 6.27

Knowledge Summary

Patent (775)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
BLEEDING DISORDER, PLATELET-TYPE, 19 1

Expression

Synonym

Accession P22612 O60850 Q5VZ02 Q86YI1 PKA C-gamma
Symbols KAPG
PKACg
BDPLT19

Gene

 Collection (1)

Gene RIF (28)

PMID Text
25061177 The missense p.74Ile>Met PRKACG mutation is associated with a marked defect in proplatelet formation and a low level in filamin A in megakaryocytes.
24189052 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
22114277 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21745501 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21651489 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21651489 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20433920 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20402410 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20392842 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
19895210 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
More...

AA Sequence

MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHY      1 - 70
AMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFS     71 - 140
EPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEI    141 - 210
ILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTK    211 - 280
RFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSE    281 - 350
F//

Text Mined References (29)

PMID Year Title
25061177 2014 A new form of macrothrombocytopenia induced by a germ-line mutation in the PRKACG gene.
19711044 2009 PKA-mediated stabilization of FoxH1 negatively regulates ERalpha activity.
19483721 2009 Overexpressing PKIB in prostate cancer promotes its aggressiveness by linking between PKA and Akt pathways.
19383776 2009 The paradoxical increase in cortisol secretion induced by dexamethasone in primary pigmented nodular adrenocortical disease involves a glucocorticoid receptor-mediated effect of dexamethasone on protein kinase A catalytic subunits.
19197368 2009 Ser276 phosphorylation of NF-kB p65 by MSK1 controls SCF expression in inflammation.
18385332 2008 Protein kinase A-induced phosphorylation of the p65 subunit of nuclear factor-kappaB promotes Schwann cell differentiation into a myelinating phenotype.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16407073 2006 Dynamic binding of PKA regulatory subunit RI alpha.
15632203 2005 Rap1GAP2 is a new GTPase-activating protein of Rap1 expressed in human platelets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...