Property Summary

NCBI Gene PubMed Count 418
PubMed Score 995.12
PubTator Score 1032.93

Knowledge Summary

Patent (162,971)

TINX Plot

  Disease Sources (9)

Disease Target Count P-value
malignant mesothelioma 3163 1.81698435138123E-9
atypical teratoid/rhabdoid tumor 1095 3.53091872837856E-7
sonic hedgehog group medulloblastoma 1482 1.16503606755704E-6
interstitial cystitis 2299 1.66547265956599E-6
medulloblastoma, large-cell 6234 2.7696532614275E-6
ulcerative colitis 2087 8.57043462542085E-6
oligodendroglioma 2849 5.95308817789452E-5
psoriasis 6685 2.96058910755779E-4
breast carcinoma 1614 0.00451623530043422
pediatric high grade glioma 2712 0.00511978011353175
Breast cancer 3099 0.00554319595388469
cutaneous lupus erythematosus 1056 0.00596355871813449
pilocytic astrocytoma 3086 0.00630263386477229
pituitary cancer 1972 0.00841983124515801
primary pancreatic ductal adenocarcinoma 1271 0.00971943051347934
colon cancer 1475 0.0134598538875931
invasive ductal carcinoma 2950 0.0147087759230624
pancreatic cancer 2300 0.0242375185474213
glioblastoma 5572 0.0437029821023161
osteosarcoma 7933 0.0497965238935303
Disease Target Count Z-score Confidence
Urinary bladder cancer 34 0.0 5.0
Disease Target Count Z-score Confidence
Craniosynostosis 47 6.585 3.3

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 4.000 0.000
cutaneous lupus erythematosus -2.000 0.006
psoriasis 1.600 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 1.168 0.050
glioblastoma -2.200 0.044
sonic hedgehog group medulloblastoma -5.100 0.000
atypical teratoid/rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -4.900 0.000
primary pancreatic ductal adenocarcinoma -1.625 0.010
colon cancer -1.600 0.013
breast carcinoma 1.500 0.005
interstitial cystitis -4.900 0.000
pediatric high grade glioma -2.200 0.005
pilocytic astrocytoma -1.400 0.006
invasive ductal carcinoma 2.100 0.015
ulcerative colitis -1.800 0.000
Breast cancer 1.200 0.006
pituitary cancer -2.900 0.008
pancreatic cancer -1.700 0.024

Synonym

Accession P22607 D3DVP9 D3DVQ0 Q14308 Q16294 Q16608 Q59FL9 FGFR-3
Symbols ACH
CEK2
JTK4
CD333
HSFGFR3EX

Gene

PDB

1RY7   2LZL   4K33  

  Ortholog (11)

 CSPA Cell Line (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (323)

PMID Text
27455559 The FGFR3, PIK3CA, TERT mutations, along with aberrant DNA methylation patterns, can serve as reliable genetic markers for the diagnosis of urinary bladder cancer. (Review)
27040652 The most notable effect of the achondroplasia mutation is increased propensity for FGFR3 dimerization in the absence of ligand.
26823787 These data suggest that nuclear translocation of FGFR3 is frequent and carries clinicopathologic as well as prognostic significances in pancreatic cancer
26711175 FGFR3 protein is frequently overexpressed in oral and oropharyngeal squamous cell carcinoma.
26708443 Our results indicate that PRMT5 is a marker of poor prognosis in NPC patients. PRMT5 promoted the radioresistance of NPC cells via targeting FGFR3, at least partly if not totally.
26542242 FGF receptor (FGFR) 3 may serve as a promising biomarker for Bladder Cancer. Mutations of this gene are prevalent in BC.
26465941 Expression of FGF-2, FGFR-2 and FGFR-3 was upregulated in patients with potentially malignant oral lesions serving as biomarkers of malignant transformation to oral squamous cell carcinoma.
26431494 analysis of FGFR3 and FGFR4 gene polymorphisms in breast cancer in Chinese women of Heilongjiang province reveals that SNPs rs1966265 and rs351855 in FGFR4 , but not rs2234909 and rs3135848 in FGFR3 are associated with breast cancer
26364695 Among patients with an FGFR3 mutation in the initial tumor, a noninvasive urine test during follow-up can be valuable in diagnosing or predicting subsequent recurrence.
26279428 miR-100 may activate MMP13 through 3'UTR-suppressoin of FGFR3 mRNA to facilitate development of lumbar disc degeneration.
More...

AA Sequence

MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMG      1 - 70
PTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDE     71 - 140
AEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQ    141 - 210
WSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSD    211 - 280
AQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHH    281 - 350
SAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK    351 - 420
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAE    421 - 490
AIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAK    491 - 560
GNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNV    561 - 630
MKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV    631 - 700
EELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQY    701 - 770
SPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT                                      771 - 806
//

Text Mined References (428)

PMID Year Title
27455559 2016 [THE SOMATIC MUTATIONS AND ABERRANT METHYLATION AS POTENTIAL GENETIC MARKERS OF URINARY BLADDER CANCER].
27040652 2016 Effect of the achondroplasia mutation on FGFR3 dimerization and FGFR3 structural response to fgf1 and fgf2: A quantitative FRET study in osmotically derived plasma membrane vesicles.
26823787 2015 Nuclear translocation of fibroblast growth factor receptor 3 and its significance in pancreatic cancer.
26711175 2016 Fibroblast growth factor receptor 3 protein is overexpressed in oral and oropharyngeal squamous cell carcinoma.
26708443 2016 Protein N-arginine methyltransferase 5 promotes the tumor progression and radioresistance of nasopharyngeal carcinoma.
26542242 2015 The role of mutations and overexpression of the fibroblast growth factor receptor-3 in bladder cancer.
26465941 2015 Fibroblast Growth Factor (FGF-2) and Its Receptors FGFR-2 and FGFR-3 May Be Putative Biomarkers of Malignant Transformation of Potentially Malignant Oral Lesions into Oral Squamous Cell Carcinoma.
26431494 2015 Association of FGFR3 and FGFR4 gene polymorphisms with breast cancer in Chinese women of Heilongjiang province.
26364695 2015 The Diagnostic and Prognostic Performance of Urinary FGFR3 Mutation Analysis in Bladder Cancer Surveillance: A Prospective Multicenter Study.
26279428 2015 Lumbar Disc Degeneration is Facilitated by MiR-100-Mediated FGFR3 Suppression.
More...