Property Summary

NCBI Gene PubMed Count 418
Grant Count 231
R01 Count 145
Funding $22,833,788.7
PubMed Score 995.12
PubTator Score 1032.93

Knowledge Summary

Patent (162,971)

TINX Plot

  Disease Relevance (71)

Disease Z-score Confidence
Achondroplasia 20 7.964 4.0
Thanatophoric dysplasia 5 7.508 3.8
Hypochondroplasia 11 7.389 3.7
Craniosynostosis 47 6.585 3.3
Acanthosis nigricans 14 5.541 2.8
Acrocephalosyndactylia 15 5.465 2.7
Cancer 2,346 5.023 2.5
Bladder transitional cell papilloma 4 4.065 2.0
Wolf-Hirschhorn syndrome 32 3.61 1.8
Keratosis 34 3.396 1.7
non-invasive bladder papillary urothelia... 4  3.317 1.7
Kabuki syndrome 27 3.277 1.6
Brachydactyly 52 3.031 1.5
Achondroplasia, Severe, With Development... 1 
Bladder Neoplasm 109
Breast cancer 3,094
CATSHL syndrome 1
CROUZON SYNDROME WITH ACANTHOSIS NIGRICA... 1 
Carcinoma 2,147 2.0
Carcinoma, Transitional Cell 31
Cervix carcinoma 6
Cleft Lip 91
Cleft palate 125
Colon Carcinoma 25
Colorectal Neoplasms 217
DOID:0050532 2 1.0
Giant Cell Glioblastoma 12
Hamman-Rich syndrome 35
Hypochondroplasia (disorder) 1
LADD syndrome 9 4.0
Lacrimoauriculodentodigital syndrome 3
Malignant neoplasm of urinary bladder 16
Muenke Syndrome 1
Multiple myeloma 1,327
NEVUS, EPIDERMAL (disorder) 4
Renal Cell Carcinoma 199
Saethre-Chotzen syndrome 9
Sarcoma of soft tissue 11
Seborrheic keratosis 6
Seminoma 15
Skeletal dysplasia, San Diego type 1
Skin cancer 37 2.0
Spermatocytic seminoma 1
THANATOPHORIC DYSPLASIA, TYPE I (disorde... 1 
Testicular Germ Cell Tumor 22
Thanatophoric dysplasia, type 2 1
Upper respiratory tract disease 7 1.0
Urinary bladder cancer 31 5.0
Urinary system cancer 2 2.0
Uterine Cervical Neoplasm 21
atypical teratoid/rhabdoid tumor 1,095
breast carcinoma 1,614
colon cancer 1,475
cutaneous lupus erythematosus 1,056
glioblastoma 5,572
gliosarcoma 19
interstitial cystitis 2,299
invasive ductal carcinoma 2,950
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
ulcerative colitis 2,087

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 4.000 0.000
cutaneous lupus erythematosus -2.000 0.006
psoriasis 1.600 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 1.168 0.050
glioblastoma -2.200 0.044
sonic hedgehog group medulloblastoma -5.100 0.000
atypical teratoid/rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -4.900 0.000
primary pancreatic ductal adenocarcinoma -1.625 0.010
colon cancer -1.600 0.013
breast carcinoma 1.500 0.005
interstitial cystitis -4.900 0.000
pediatric high grade glioma -2.200 0.005
pilocytic astrocytoma -1.400 0.006
invasive ductal carcinoma 2.100 0.015
ulcerative colitis -1.800 0.000
Breast cancer 1.200 0.006
pituitary cancer -2.900 0.008
pancreatic cancer -1.700 0.024

Synonym

Accession P22607 D3DVP9 D3DVQ0 Q14308 Q16294 Q16608 Q59FL9 FGFR-3
Symbols ACH
CEK2
JTK4
CD333
HSFGFR3EX

Gene

PDB

1RY7   2LZL   4K33  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (323)

PMID Text
27455559 The FGFR3, PIK3CA, TERT mutations, along with aberrant DNA methylation patterns, can serve as reliable genetic markers for the diagnosis of urinary bladder cancer. (Review)
27040652 The most notable effect of the achondroplasia mutation is increased propensity for FGFR3 dimerization in the absence of ligand.
26823787 These data suggest that nuclear translocation of FGFR3 is frequent and carries clinicopathologic as well as prognostic significances in pancreatic cancer
26711175 FGFR3 protein is frequently overexpressed in oral and oropharyngeal squamous cell carcinoma.
26708443 Our results indicate that PRMT5 is a marker of poor prognosis in NPC patients. PRMT5 promoted the radioresistance of NPC cells via targeting FGFR3, at least partly if not totally.
26542242 FGF receptor (FGFR) 3 may serve as a promising biomarker for Bladder Cancer. Mutations of this gene are prevalent in BC.
26465941 Expression of FGF-2, FGFR-2 and FGFR-3 was upregulated in patients with potentially malignant oral lesions serving as biomarkers of malignant transformation to oral squamous cell carcinoma.
26431494 analysis of FGFR3 and FGFR4 gene polymorphisms in breast cancer in Chinese women of Heilongjiang province reveals that SNPs rs1966265 and rs351855 in FGFR4 , but not rs2234909 and rs3135848 in FGFR3 are associated with breast cancer
26364695 Among patients with an FGFR3 mutation in the initial tumor, a noninvasive urine test during follow-up can be valuable in diagnosing or predicting subsequent recurrence.
26279428 miR-100 may activate MMP13 through 3'UTR-suppressoin of FGFR3 mRNA to facilitate development of lumbar disc degeneration.
More...

AA Sequence

MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMG      1 - 70
PTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDE     71 - 140
AEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQ    141 - 210
WSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSD    211 - 280
AQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHH    281 - 350
SAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK    351 - 420
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAE    421 - 490
AIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAK    491 - 560
GNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNV    561 - 630
MKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV    631 - 700
EELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQY    701 - 770
SPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT                                      771 - 806
//

Text Mined References (428)

PMID Year Title
27455559 2016 [THE SOMATIC MUTATIONS AND ABERRANT METHYLATION AS POTENTIAL GENETIC MARKERS OF URINARY BLADDER CANCER].
27040652 2016 Effect of the achondroplasia mutation on FGFR3 dimerization and FGFR3 structural response to fgf1 and fgf2: A quantitative FRET study in osmotically derived plasma membrane vesicles.
26823787 2015 Nuclear translocation of fibroblast growth factor receptor 3 and its significance in pancreatic cancer.
26711175 2016 Fibroblast growth factor receptor 3 protein is overexpressed in oral and oropharyngeal squamous cell carcinoma.
26708443 2016 Protein N-arginine methyltransferase 5 promotes the tumor progression and radioresistance of nasopharyngeal carcinoma.
26542242 2015 The role of mutations and overexpression of the fibroblast growth factor receptor-3 in bladder cancer.
26465941 2015 Fibroblast Growth Factor (FGF-2) and Its Receptors FGFR-2 and FGFR-3 May Be Putative Biomarkers of Malignant Transformation of Potentially Malignant Oral Lesions into Oral Squamous Cell Carcinoma.
26431494 2015 Association of FGFR3 and FGFR4 gene polymorphisms with breast cancer in Chinese women of Heilongjiang province.
26364695 2015 The Diagnostic and Prognostic Performance of Urinary FGFR3 Mutation Analysis in Bladder Cancer Surveillance: A Prospective Multicenter Study.
26279428 2015 Lumbar Disc Degeneration is Facilitated by MiR-100-Mediated FGFR3 Suppression.
More...