Property Summary

NCBI Gene PubMed Count 25
PubMed Score 376.32
PubTator Score 256.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.301 4.5e-06
atypical teratoid / rhabdoid tumor 1.200 1.7e-04
lung cancer 1.200 9.3e-04
malignant mesothelioma -1.900 6.7e-07
ovarian cancer -1.700 2.8e-08
posterior fossa group B ependymoma 1.100 2.2e-04

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEK      1 - 70
QPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRA     71 - 140
LEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKA    141 - 210
ALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELL    211 - 280
LRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMED    281 - 350
LPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM    351 - 420
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLG    421 - 490
H//

Text Mined References (30)

PMID Year Title