Property Summary

NCBI Gene PubMed Count 24
Grant Count 26
R01 Count 21
Funding $2,466,835.25
PubMed Score 376.58
PubTator Score 256.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
acute quadriplegic myopathy 1.301 0.000
lung cancer 1.200 0.001
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer -1.700 0.000

Gene RIF (8)

PMID Text
25712867 NOS-3 overexpression resulted in an increased sensitivity to anti-Fas induced cell death, independently of AR expression and CatD activity.
24321386 These results indicated that abundant FDXR expression in these steroidogenic cells was maintained through SF-1 binding to the intronic enhancer of the FDXR gene
22101253 results suggest that both FDX1 and FDX2 and their likely reductase partner, FDXR, contribute to iron-sulfur cluster biogenesis
20877624 Observational study of gene-disease association. (HuGE Navigator)
18319262 Fhit interaction with ferredoxin reductase triggers generation of reactive oxygen species and apoptosis of cancer cells
12782149 ADXR rate of hydroxylation was linear with incubation time.
12370809 The ferredoxin reductase gene is regulated by the p53 family and sensitizes cells to oxidative stress-induced apoptosis
12137805 comparison of catalytic properties between conditions of limiting and saturating adrenodoxin reductase [cytochrome P450scc]

AA Sequence

MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEK      1 - 70
QPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRA     71 - 140
LEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKA    141 - 210
ALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELL    211 - 280
LRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMED    281 - 350
LPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM    351 - 420
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLG    421 - 490
H//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25712867 2015 Sensitivity to anti-Fas is independent of increased cathepsin D activity and adrenodoxin reductase expression occurring in NOS-3 overexpressing HepG2 cells.
24321386 2014 Transcriptional regulation of human ferredoxin reductase through an intronic enhancer in steroidogenic cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22101253 2012 Both human ferredoxins 1 and 2 and ferredoxin reductase are important for iron-sulfur cluster biogenesis.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18319262 2008 Fhit interaction with ferredoxin reductase triggers generation of reactive oxygen species and apoptosis of cancer cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...