Property Summary

NCBI Gene PubMed Count 52
PubMed Score 149.71
PubTator Score 142.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma -1.400 2.6e-02
dermatomyositis 1.200 4.2e-02
group 3 medulloblastoma -1.300 4.4e-03
lung adenocarcinoma -1.300 1.6e-08
mucosa-associated lymphoid tissue lympho... 4.253 9.2e-03
osteosarcoma -6.999 1.2e-05
ovarian cancer -1.700 5.1e-05
tuberculosis 2.300 2.0e-02

Gene RIF (33)

AA Sequence

MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHC      1 - 70
PFMLSELQDGKSKIVQKAAPEVQEDVKAFKTDLPSSLVSVSLRKPFSGPQEQEQISGKVTHLIQNNMPGN     71 - 140
YVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQ    141 - 210
ATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYS    211 - 280
DAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKLLEKSNPKIPKIVAFETVHSMDGAICPLEELCDVSHQY    281 - 350
GALTFVDEVHAVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFT    351 - 420
TSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAALNSKLC    421 - 490
DLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNFCRR    491 - 560
PVHFELMSEWERSYFGNMGPQYVTTYA                                               561 - 587
//

Text Mined References (54)

PMID Year Title