1. Home
  2. Targets
  3. Small proline-rich protein 2D

Tdark Small proline-rich protein 2D

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

 Comments

Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.13
PubTator Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 0.0
diabetes mellitus 1663 0.00104821351867176
Disease Target Count Z-score Confidence
Seborrheic dermatitis 19 4.248 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.300 0.001
psoriasis 5.900 0.000

Synonym

Accession P22532 A4QN03 A8K5K2 D3DV33 Q5T523 Q96RM3 SPR-2D
Symbols

Gene

SPRR2D

  Ortholog (1)

Species Source
Chimp OMA EggNOG

 GO Function (1)

 GO Component (2)

 GO Process (4)

 Compartment GO Term (10)

 HCA RNA Cell Line (26)

See all...

Pathway (3)

 UniProt Keyword (6)

Gene RIF (1)

PMID Text
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.

AA Sequence 

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (13)

PMID Year Title
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16639001 2006 Expression and regulation of cornified envelope proteins in human corneal epithelium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15232223 2004 Estrogen regulates the expression of the small proline-rich 2 gene family in the mouse uterus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12786819 2003 Differential expression of cornified cell envelope precursors in normal skin, intraorally transplanted skin and normal oral mucosa.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11279051 2001 Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function.
More...