Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.33
PubTator Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 0.0e+00
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Seborrheic dermatitis 31 4.315 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.300 1.0e-03
psoriasis 5.900 0.0e+00

Gene RIF (1)

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (13)

PMID Year Title