Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.6e-274

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.800 8.6e-274

Gene RIF (1)

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (11)

PMID Year Title