Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.800 0.000

Gene RIF (1)

PMID Text
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (10)

PMID Year Title
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15232223 2004 Estrogen regulates the expression of the small proline-rich 2 gene family in the mouse uterus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279051 2001 Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function.
9888996 1999 Mouse Sprr2 genes: a clustered family of genes showing differential expression in epithelial tissues.
9722562 1998 Structural and transglutaminase substrate properties of the small proline-rich 2 family of cornified cell envelope proteins.
8325635 1993 Molecular characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins.
3133554 1988 Isolation, characterization, and UV-stimulated expression of two families of genes encoding polypeptides of related structure in human epidermal keratinocytes.