Property Summary

NCBI Gene PubMed Count 21
Grant Count 18
R01 Count 15
Funding $935,649.97
PubMed Score 26.70
PubTator Score 22.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -4.900 0.022
psoriasis 3.600 0.000
cutaneous lupus erythematosus 1.600 0.002
non-small cell lung cancer 5.245 0.000
intraductal papillary-mucinous neoplasm ... 3.100 0.017
pancreatic cancer 2.300 0.004
lung cancer -5.000 0.007
cystic fibrosis 1.900 0.000
nasopharyngeal carcinoma -2.400 0.011
ulcerative colitis 2.400 0.025

Gene RIF (6)

PMID Text
23954638 expression of SPRR1B is upregulated in oral CSCs/CICs and SPRR1B has a role in cell growth by suppression of RASSF4
19601998 Observational study of gene-disease association. (HuGE Navigator)
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
18172072 SPRR1B is a valid biomarker for the study of the molecular mechanisms of squamous metaplasia. There is a definitive link between inflammation and squamous metaplasia in autoimmune-mediated dry eye disease
12832281 SPRR1B expression pattern in nonsquamous tumors; findings indicate SPRR1B likely coupled to signals responsible for withdrawal from the proliferative state; overexpression for prolonged periods may disrupt normal progression of mitosis
12091247 BMK1 (ERK5) regulates squamous differentiation marker SPRR1B transcription in Clara-like H441 cells.

AA Sequence

MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVP      1 - 70
EPCPSIVTPAPAQQKTKQK                                                        71 - 89
//

Text Mined References (22)

PMID Year Title
23954638 2013 Small proline-rich protein-1B is overexpressed in human oral squamous cell cancer stem-like cells and is related to their growth through activation of MAP kinase signal.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
18172072 2008 Small proline-rich protein 1B (SPRR1B) is a biomarker for squamous metaplasia in dry eye disease.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12832281 2003 SPRR1B overexpression enhances entry of cells into the G0 phase of the cell cycle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...