Property Summary

NCBI Gene PubMed Count 22
PubMed Score 27.12
PubTator Score 22.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 1.8e-03
cystic fibrosis 1.900 3.9e-04
esophageal adenocarcinoma -4.900 2.2e-02
intraductal papillary-mucinous neoplasm ... 3.100 1.7e-02
lung cancer -5.000 6.8e-03
nasopharyngeal carcinoma -2.400 1.1e-02
non-small cell lung cancer 5.245 3.0e-14
pancreatic cancer 2.300 4.1e-03
psoriasis 2.200 4.1e-05
ulcerative colitis 2.400 2.5e-02

Synonym

Accession P22528 B2R5H7 P22529 P22530 Q5T524
Symbols SPRR1
GADD33
SPR-IB
CORNIFIN

Gene

  Ortholog (1)

Species Source Disease
Cow OMA EggNOG

Gene RIF (7)

AA Sequence

MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVP      1 - 70
EPCPSIVTPAPAQQKTKQK                                                        71 - 89
//

Text Mined References (23)

PMID Year Title