Property Summary

NCBI Gene PubMed Count 100
Grant Count 377
R01 Count 184
Funding $52,476,566.92
PubMed Score 2197.75
PubTator Score 229.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 5.400 0.000
psoriasis -3.300 0.000
osteosarcoma 1.024 0.040
glioblastoma 1.800 0.020
Atopic dermatitis -2.700 0.029
non-small cell lung cancer 1.222 0.000
lung cancer 1.600 0.001
pediatric high grade glioma 1.300 0.036
posterior fossa group A ependymoma 1.200 0.045
Endometriosis -1.376 0.026
ulcerative colitis 1.100 0.002
pituitary cancer -7.300 0.000

Synonym

Accession P22466 Q14413
Symbols ETL8
GALN
GLNN
GMAP
GAL-GMAP

Gene

GAL

Gene RIF (65)

PMID Text
26621352 This study demonstrated that Galanin upregulation within the basal forebrain cholinergic system in LBD
26572146 GAL and its receptors, GALR1 and GALR2, play a role in head and neck squamous cell carcinoma tumorigenesis
26253934 Elevated galanin may predict the risk of type 2 diabetes mellitus for development of Alzheimer's disease.
26122049 This is the first report of the various galanin receptors in the human eye.
25917569 Galanin released by cancer induces neuritogenesis, facilitating perineural invasion.
25779965 Galangin-induced down-regulation of BACE1 by epigenetic mechanisms
25691535 Mutations in the human GAL gene cause temporal lobe epilepsy.
25545502 Galanin can be regarded as an immunomodulatory peptide as it can sensitize polymorphonuclear neutrophils towards pro-inflammatory cytokines in humans and mice.
25504183 Data shows that high expression of GAL is associated with poor prognosis of stage II colorectal cancer patients (CRC) and GAL expression may be related to the aggressive behavior of CRC.
25228436 found no association of the galanin enhancer genotype with any of the other pathophysiological parameters measured
More...

AA Sequence

MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPED      1 - 70
DMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS                      71 - 123
//

Text Mined References (106)

PMID Year Title
26621352 2015 Differential expression of galanin in the cholinergic basal forebrain of patients with Lewy body disorders.
26572146 2016 Epigenetic inactivation of galanin and GALR1/2 is associated with early recurrence in head and neck cancer.
26253934 2015 Elevated galanin may predict the risk of type 2 diabetes mellitus for development of Alzheimer's disease.
26122049 2015 Distribution of galanin receptors in the human eye.
25917569 2015 Galanin modulates the neural niche to favour perineural invasion in head and neck cancer.
25779965 2015 Galangin-induced down-regulation of BACE1 by epigenetic mechanisms in SH-SY5Y cells.
25691535 2015 Galanin pathogenic mutations in temporal lobe epilepsy.
25545502 2015 Galanin modulates human and murine neutrophil activation in vitro.
25504183 2015 Galanin plays an important role in cancer invasiveness and is associated with poor prognosis in stage II colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
More...