Property Summary

NCBI Gene PubMed Count 106
PubMed Score 2240.21
PubTator Score 229.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Atopic dermatitis -2.700 2.9e-02
Endometriosis -1.376 2.6e-02
glioblastoma 1.800 2.0e-02
lung cancer 1.600 1.3e-03
malignant mesothelioma 5.400 1.3e-08
non-small cell lung cancer 1.222 1.4e-07
osteosarcoma 1.024 4.0e-02
pediatric high grade glioma 1.300 3.6e-02
pituitary cancer -7.300 2.0e-15
posterior fossa group A ependymoma 1.200 4.5e-02
psoriasis -3.000 6.5e-04
ulcerative colitis 1.100 1.8e-03

Protein-protein Interaction (2)

Gene RIF (71)

AA Sequence

MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPED      1 - 70
DMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS                      71 - 123
//

Text Mined References (112)

PMID Year Title