Property Summary

NCBI Gene PubMed Count 103
Grant Count 147
R01 Count 117
Funding $15,956,015.57
PubMed Score 405.90
PubTator Score 343.66

Knowledge Summary

Patent (42,372)

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.057 0.009
posterior fossa group B ependymoma 2.300 0.000
medulloblastoma, large-cell 1.400 0.029
lung cancer -1.100 0.025
colon cancer -1.300 0.001
group 4 medulloblastoma 3.900 0.000
ovarian cancer 1.400 0.002
pituitary cancer 2.200 0.000

Synonym

Accession P22460 Q4KKT8 Q4VAJ1 Q4VAJ2 Q9UDA4
Symbols HK2
HCK1
PCN1
ATFB7
HPCN1
KV1.5

Gene

Gene RIF (84)

PMID Text
26874203 demonstrate that PK treatment cleaved mature membrane-bound (75kDa) Kv1.5 channels at a single locus in the S1-S2 linker, producing 42-kDa N-terminal fragments and 33-kDa C-terminal fragments
26573141 Studies demonstrate that DNA hypermethylation contributes to epigenetic repression of the KCNA5 locus and that the resulting suppression of the Kv1.5 ion channel supports cancer cell proliferation.
26569226 Kv1.5 expression is increased in osteosarcoma cells and tissues and shRNA mediated silencing of Kv1.5 results in cell proliferation inhibition, cell cycle arrest, and induces cell apoptosis.
26292661 Putative binding sites for arachidonic acid on the human cardiac Kv 1.5 channel
26256861 Direct interaction with specific amino acids underlies the blocking action of propofol on voltage-gated hKv1.5 channel.
26232501 These results indicate that CHIP decreases the Kv1.5 protein level and functional channel by facilitating its degradation in concert with chaperone Hsc70
26129877 One KCNA5 variant, H463R, was a novel mutation; the histidine at codon 463 is located in the S5-pore loop, in the vicinity of the pore of KV1.5 subunit. The other variant, T527M, showed a gain-of-function effect with an enhanced steady-state activation.
25918274 The expression of Kv1.5 channel protein changes with atrial fibrillation but not with age, rheumatic heart diseases, and sex in atrial fibrillation.
25435365 The KCNA5 promoter is marked in cancer cells with PcG-dependent chromatin repressive modifications that increase in hypoxia.
24946104 Protein kinase C inhibition results in a Kv 1.5 and Kv beta 1.3 pharmacology closer to Kv 1.5 channels
More...

AA Sequence

MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDADSGVRPLPPL      1 - 70
PDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQRVHINISGLRFETQLGTLAQ     71 - 140
FPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAM    141 - 210
ERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERE    211 - 280
LLRHPPAPHQPPAPAPGANGSGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKA    281 - 350
GFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL    351 - 420
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTTVGYGDMRPIT    421 - 490
VGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQGTQSQGPGLDRGVQRKVSGSR    491 - 560
GSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSLYALCLDTSRETDL                     561 - 613
//

Text Mined References (109)

PMID Year Title
26874203 2016 Proteolytic cleavage in the S1-S2 linker of the Kv1.5 channel does not affect channel function.
26573141 2016 Promoter Methylation Analysis Reveals That KCNA5 Ion Channel Silencing Supports Ewing Sarcoma Cell Proliferation.
26569226 2015 Silencing of Kv1.5 Gene Inhibits Proliferation and Induces Apoptosis of Osteosarcoma Cells.
26292661 2015 Putative binding sites for arachidonic acid on the human cardiac Kv 1.5 channel.
26256861 2015 Interaction of propofol with voltage-gated human Kv1.5 channel through specific amino acids within the pore region.
26232501 2015 E3 ligase CHIP and Hsc70 regulate Kv1.5 protein expression and function in mammalian cells.
26129877 2015 Functional Characterization of Rare Variants Implicated in Susceptibility to Lone Atrial Fibrillation.
25918274 2015 Remodeling of Kv1.5 channel in right atria from Han Chinese patients with atrial fibrillation.
25435365 2015 Polycomb-dependent repression of the potassium channel-encoding gene KCNA5 promotes cancer cell survival under conditions of stress.
24946104 2014 PKC inhibition results in a Kv 1.5 + Kv ?1.3 pharmacology closer to Kv 1.5 channels.
More...