Property Summary

Ligand Count 553
NCBI Gene PubMed Count 106
PubMed Score 428.34
PubTator Score 343.66

Knowledge Summary

Patent (42,372)

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -1.300 6.1e-04
ependymoma 1.300 1.4e-03
group 3 medulloblastoma 3.800 1.3e-06
lung cancer -1.100 2.5e-02
medulloblastoma, large-cell 1.400 2.9e-02
osteosarcoma -1.057 9.3e-03
ovarian cancer 1.400 2.3e-03
pituitary cancer 2.200 2.5e-08

Gene RIF (86)

AA Sequence

MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDADSGVRPLPPL      1 - 70
PDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQRVHINISGLRFETQLGTLAQ     71 - 140
FPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAM    141 - 210
ERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERE    211 - 280
LLRHPPAPHQPPAPAPGANGSGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKA    281 - 350
GFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL    351 - 420
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTTVGYGDMRPIT    421 - 490
VGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQGTQSQGPGLDRGVQRKVSGSR    491 - 560
GSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSLYALCLDTSRETDL                     561 - 613
//

Text Mined References (112)

PMID Year Title