Property Summary

NCBI Gene PubMed Count 43
Grant Count 52
R01 Count 37
Funding $4,795,937.83
PubMed Score 192.01
PubTator Score 108.35

Knowledge Summary

Patent (10,492)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 2.200 0.000
pituitary cancer 1.300 0.000

Gene RIF (12)

PMID Text
22560931 Expression of Kv1.4 appears to increase in the spinal cord of mice modelling remitting-relapsing experimental allergic encephalomyelitis (rrEAE) in peak and remitting phases.
21945024 Detection of the methylation prevalence of KCNA4 and CYP26B1 together in serum demonstrated the good sensitivity and specificityin gastric cancer
21307345 Data suggest that episodic ataxia type 1 mutations affect fast inactivation of Kv1.1/1.4 channels by a reduction in either subunit surface expression or altered affinity for the inactivation domain.
19961828 Sialylated N-glycans uniquely impact gating of a mammalian Shaker family K(v) channel isoform, K(v)1.5, but have no effect on gating of a second Shaker isoform, K(v)1.4.
19453640 Both arachidonic acid and Trolox potently modulate Kv1.4 and Kv4.2 channel alpha-subunits, thereby presumably tuning presynaptic transmitter release and postsynaptic somatodendritic excitability in synaptic transmission and plasticity.
18640987 Thr-330 of Kv1.4 serves to interlock the voltage-sensing and gating domains of adjacent monomers, thereby yielding a structure competent for the surface expression of functional tetramers
17959711 Ginsenoside Rg3 inhibits KV1.4 channel currents by interacting with the lysine531 residue.
17156368 The results demonstrate that the human Kvbeta1.1 and Kvbeta1.2 subunits regulate the proportion of wild-type Kv1.4-1.1 channels that are available to open.
16308273 Fast inactivation in human Kv1.4 is modulated by structural elements in the C-terminus, suggesting that the process involves the concerted action of the N- and C-termini.
15955806 Novel role for GIP in regulating K(V)1.4 cell surface expression and modulation of A-type potassium currents
More...

AA Sequence

MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGSHHHHQSRGA      1 - 70
CTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRF     71 - 140
YYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQ    141 - 210
YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEE    211 - 280
DRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGL    281 - 350
LNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLG    351 - 420
TDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVI    421 - 490
LFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIV    491 - 560
SNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQ    561 - 630
GKGDDSETDKNNCSNAKAVETDV                                                   631 - 653
//

Text Mined References (45)

PMID Year Title
27619418 2016 Pore size matters for potassium channel conductance.
22560931 2012 K+ channel alterations in the progression of experimental autoimmune encephalomyelitis.
21945024 2011 Hypermethylated DNA as potential biomarkers for gastric cancer diagnosis.
21307345 2011 Episodic ataxia type 1 mutations affect fast inactivation of K+ channels by a reduction in either subunit surface expression or affinity for inactivation domain.
19968958 2010 Potassium channel regulator KCNRG regulates surface expression of Shaker-type potassium channels.
19961828 2010 N-glycans modulate K(v)1.5 gating but have no effect on K(v)1.4 gating.
19912772 1990 Human potassium channel genes: Molecular cloning and functional expression.
19453640 2009 Arachidonic acid potently inhibits both postsynaptic-type Kv4.2 and presynaptic-type Kv1.4 IA potassium channels.
18640987 2008 Identification of an evolutionarily conserved extracellular threonine residue critical for surface expression and its potential coupling of adjacent voltage-sensing and gating domains in voltage-gated potassium channels.
17959711 2008 Ginsenoside Rg3 inhibits human Kv1.4 channel currents by interacting with the Lys531 residue.
More...