Property Summary

Ligand Count 9
NCBI Gene PubMed Count 43
PubMed Score 199.78
PubTator Score 108.35

Knowledge Summary

Patent (10,492)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 2.200 1.2e-19
pituitary cancer 1.300 7.2e-05

Gene RIF (12)

AA Sequence

MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGSHHHHQSRGA      1 - 70
CTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRF     71 - 140
YYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQ    141 - 210
YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEE    211 - 280
DRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGL    281 - 350
LNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLG    351 - 420
TDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVI    421 - 490
LFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIV    491 - 560
SNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQ    561 - 630
GKGDDSETDKNNCSNAKAVETDV                                                   631 - 653
//

Text Mined References (45)

PMID Year Title