Property Summary

NCBI Gene PubMed Count 176
Grant Count 81
R01 Count 49
Funding $6,496,751.89
PubMed Score 255.83
PubTator Score 266.12

Knowledge Summary

Patent (139,693)

Expression

  Differential Expression (7)

Synonym

Accession P22455 G3JVM2 G3JVM5 G3JVM7 G3JVM9 O43785 Q14309 Q71TW8 Q8TDA0 Q96KE5 FGFR-4
Symbols TKF
JTK2
CD334

Gene

PDB

1QCT   4QQ5   4QQC   4QQJ   4QQT   4QRC   4R6V   4TYE   4TYG   4TYI   4TYJ   4UXQ   4XCU  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (137)

PMID Text
26856750 The FGFR4 single-nucleotide polymorphism rs376618 had borderline significant differences in Patients With Primary Bile Acid Diarrhea.
26840079 Our study provides the first evidence of a role for FGFR4 in neuroblastoma
26675719 Using Fgfr4 single nucleotide polymorphism knock-in mice and transgenic mouse models for breast and lung cancers, we validate the enhanced STAT3 signalling induced by the FGFR4 Arg388-variant in vivo
26551585 FGFR4 is overexpressed in oral squamous cell carcinoma (OSCC) and oropharyngeal squamous cell carcinoma (OPSCC) in the absence of gene amplification, and may serve as a potential predictive marker for FGFR4-directed targeted therapy in OSCC and OPSCC.
26431494 analysis of FGFR3 and FGFR4 gene polymorphisms in breast cancer in Chinese women of Heilongjiang province reveals that SNPs rs1966265 and rs351855 in FGFR4 , but not rs2234909 and rs3135848 in FGFR3 are associated with breast cancer
26323668 Study shows that FGF19 can be secreted and promotes ovarian cancer progression such as proliferation and invasion by activating FGFR4.
26152288 KL methylation is a characteristic of many breast cancer cases . However, the resulting or associated perturbation in FGFR4 expression, similar to FGF19, could be utilized as a biomarker for poor prognosis
25860955 The genetic polymorphism in FGFR4 rs351855 may be associated with the risk of HCC coupled with liver cirrhosis and may markedly increase the AFP level
25684949 High tumor expression of FGFR4 protein is not an independent risk factor for gastric cancer initiation, but is a useful prognostic marker for GC patients when the tumor is relatively small, well differentiated, or in the early stages of invasion.
25349422 The structural basis for dual FGFR and EGFR targeting by FIIN3 also is illustrated by crystal structures of FIIN-3 bound with FGFR4 V550L and EGFR L858R.
More...

AA Sequence

MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEG      1 - 70
SRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRH     71 - 140
SYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLV    141 - 210
MESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPH    211 - 280
IQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTV    281 - 350
LPEEDPTWTAAAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL    351 - 420
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMD    421 - 490
PARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLRE    491 - 560
FLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIAD    561 - 630
FGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS    631 - 700
LLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGD    701 - 770
ASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT                                          771 - 802
//

Text Mined References (187)

PMID Year Title
26856750 2016 Characterizing Factors Associated With Differences in FGF19 Blood Levels and Synthesis in Patients With Primary Bile Acid Diarrhea.
26840079 2016 A Polymorphism in the FGFR4 Gene Is Associated With Risk of Neuroblastoma and Altered Receptor Degradation.
26675719 2015 Germline variant FGFR4 ?p.G388R exposes a membrane-proximal STAT3 binding site.
26551585 2015 FGFR4 Is a Potential Predictive Biomarker in Oral and Oropharyngeal Squamous Cell Carcinoma.
26431494 2015 Association of FGFR3 and FGFR4 gene polymorphisms with breast cancer in Chinese women of Heilongjiang province.
26323668 2015 Fibroblast growth factor 19 is correlated with an unfavorable prognosis and promotes progression by activating fibroblast growth factor receptor 4 in advanced-stage serous ovarian cancer.
26152288 2015 Frequent methylation of the KLOTHO gene and overexpression of the FGFR4 receptor in invasive ductal carcinoma of the breast.
25860955 2015 Fibroblast growth factor receptor 4 polymorphism is associated with liver cirrhosis in hepatocarcinoma.
25684949 2015 Fibroblast growth factor receptor 4 protein expression and clinicopathological features in gastric cancer.
25349422 2014 Development of covalent inhibitors that can overcome resistance to first-generation FGFR kinase inhibitors.
More...