Property Summary

NCBI Gene PubMed Count 130
Grant Count 337
R01 Count 131
Funding $71,461,234.79
PubMed Score 586.95
PubTator Score 315.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma -1.100 0.004
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.700 0.000
adult high grade glioma -1.100 0.015

Synonym

Accession P22415 B2RBZ4 Q5SY46 Q7Z5Y1
Symbols UEF
FCHL
MLTF
FCHL1
MLTFI
HYPLIP1
bHLHb11

Gene

PDB

1AN4  

Gene RIF (116)

PMID Text
26819196 SNP (single-nucleotide polymorphism) alleles that reduced USF1 mRNA expression also displayed a beneficial cardiometabolic profile, featuring improved insulin sensitivity, a favorable lipid profile, and reduced atherosclerosis
26772882 USF1 gene can take part in basal transcription regulation of the human A3G gene in hepatocyte, and the identified E-box represented a binding site for the USF1.
26297580 Rta autoregulates BRLF1 transcription via its interaction with USF1 on E1.
26068452 A trend of increasing triglycerides levels in relation to the C allele dose of rs2516839 SNP was observed. The synergistic effect of cigarette smoking and C allele carrier state on CAD risk was found.
25480412 Further studies may be needed to validate our results and gain insights into the pathological mechanism of USF1 gene in the HCC tumorigenesis.
25374392 Our results provided a new insight into susceptibility of USF1 variant with male infertility. rs11204546 of OR2W3 and rs11677854 of GTF2A1L might be additional valuable molecular predictive markers
25367853 A significantly elevated genotype frequency in certain USF1 genes was observed in hepatocellular carcinoma patients.
25308402 Results show that the USF1 and APOA5 polymorphisms are associated with Familial combined hyperlipidemia and that the S19W SNP in the APOA5 gene is associated to the disease independently of total cholesterol, triglycerides and body mass index.
25194820 CK2 phosphorylation of USF1 modulates two functionally important properties of USF1, namely hetero-dimerization and transactivation.
25149140 Increased upstream stimulatory factor in HCC is associated with heparanase expression. USF might be an important factor in regulating HPSE expression and act as a novel marker of metastatic recurrence of HCC patients
More...

AA Sequence

MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ      1 - 70
LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV     71 - 140
TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR    141 - 210
RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ    211 - 280
QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN                                            281 - 310
//

Text Mined References (134)

PMID Year Title
27141965 2016 Setd1a and NURF mediate chromatin dynamics and gene regulation during erythroid lineage commitment and differentiation.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26819196 2016 USF1 deficiency activates brown adipose tissue and improves cardiometabolic health.
26772882 2016 Basal transcription of APOBEC3G is regulated by USF1 gene in hepatocyte.
26297580 2015 Transcriptional activation of Epstein-Barr virus BRLF1 by USF1 and Rta.
26068452 2015 The rs2516839 Polymorphism of the USF1 Gene May Modulate Serum Triglyceride Levels in Response to Cigarette Smoking.
25480412 2015 Significant association between upstream transcription factor 1 rs2516839 polymorphism and hepatocellular carcinoma risk: a case-control study.
25416956 2014 A proteome-scale map of the human interactome network.
25374392 2015 Association of single nucleotide polymorphisms in the USF1, GTF2A1L and OR2W3 genes with non-obstructive azoospermia in the Chinese population.
25367853 2014 Two polymorphisms of USF1 gene (-202G>A and -844C>T) may be associated with hepatocellular carcinoma susceptibility based on a case-control study in Chinese Han population.
More...