Property Summary

NCBI Gene PubMed Count 132
PubMed Score 593.81
PubTator Score 315.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 1.5e-02
atypical teratoid / rhabdoid tumor -1.700 4.2e-09
glioblastoma -1.500 1.7e-06
medulloblastoma, large-cell -1.700 4.1e-05
oligodendroglioma -1.100 4.4e-03

Protein-protein Interaction (3)

Gene RIF (118)

AA Sequence

MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ      1 - 70
LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV     71 - 140
TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR    141 - 210
RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ    211 - 280
QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN                                            281 - 310
//

Text Mined References (137)

PMID Year Title