Property Summary

Ligand Count 22
NCBI Gene PubMed Count 207
PubMed Score 552.80
PubTator Score 357.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Ossification of the posterior longitudinal ligament of spine 9
Osteomalacia 35
Abnormal skeletal development 60
Abnormal trabecular bone morphology 6
Abnormality of renal excretion 2
Abnormality of the cerebral vasculature 6
Angioid streaks 11
Autosomal recessive hypophosphatemic vitamin D refractory rickets 2
Autosomal recessive predisposition 1442
Bone pain 42
Calcification of coronary artery 3
Congestive heart failure 113
Contractures of the large joints 5
Craniosynostosis 74
Dental abscess 4
Diabetes Mellitus, Non-Insulin-Dependent 145
Distal femoral bowing 3
Ecchymosis 66
Enlargement of the wrists 5
Enthesitis 3
Exanthema 43
Excess nuchal skin 30
Excessive wrinkled skin 16
Generalized arterial calcification 1
Genu varum 29
Heart failure 162
Hip joint varus deformity - observation 24
Hyperkeratosis 50
Hyperphosphaturia 21
Hypertensive disease 292
Hypophosphatemic Rickets 11
Idiopathic arterial calcification of infancy 2
Increase in blood pressure 119
Increased serum bone-specific alkaline phosphatase 4
Increased tendency to bruise 66
Late tooth eruption 61
Leg Length Inequality 6
Linear atrophy 15
Low serum calcitriol 2
Malabsorption 82
Myocardial Infarction 151
Myopia 176
Osteochondrodysplasias 72
Osteosclerosis 31
Polyarthritis 11
Pseudo-fractures 2
Renal hypophosphatemia 2
Renal phosphate wasting 7
Retinal Diseases 55
Retinal Hemorrhage 6
Rickets of the lower limbs 2
SACROILIAC JOINT ABNORMALITY 2
Sensorineural Hearing Loss (disorder) 284
Short stature 531
Skull malformation 38
Spinal canal stenosis 12
Tibial bowing 19
Urine phosphorous concentration above normal 21
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hypophosphatemia 40 3.636 1.8
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.024 2.0

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer 2.600 3.9e-02
colon cancer -1.800 2.2e-03
Crohn's disease -1.056 1.2e-02
cystic fibrosis 1.985 8.0e-07
intraductal papillary-mucinous adenoma (... -1.900 2.5e-04
intraductal papillary-mucinous carcinoma... -1.200 3.4e-02
intraductal papillary-mucinous neoplasm ... -1.800 4.2e-03
invasive ductal carcinoma 1.202 1.1e-02
lung cancer 2.100 9.5e-05
lung carcinoma 1.600 3.7e-18
osteosarcoma -2.561 1.0e-02
ovarian cancer 2.300 6.4e-04
pancreatic ductal adenocarcinoma liver m... -1.373 4.5e-03
pituitary cancer -3.400 1.9e-07
subependymal giant cell astrocytoma 1.303 3.2e-02
ulcerative colitis -1.368 3.2e-03

 GWAS Trait (1)

Gene RIF (231)

AA Sequence

MERDGCAGGGSRGGEGGRAPREGPAGNGRDRGRSHAAEAPGDPQAAASLLAPMDVGEEPLEKAARARTAK      1 - 70
DPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETC     71 - 140
IEPEHIWTCNKFRCGEKRLTRSLCACSDDCKDKGDCCINYSSVCQGEKSWVEEPCESINEPQCPAGFETP    141 - 210
PTLLFSLDGFRAEYLHTWGGLLPVISKLKKCGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMY    211 - 280
DPKMNASFSLKSKEKFNPEWYKGEPIWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYNGSVPFEERI    281 - 350
LAVLQWLQLPKDERPHFYTLYLEEPDSSGHSYGPVSSEVIKALQRVDGMVGMLMDGLKELNLHRCLNLIL    351 - 420
ISDHGMEQGSCKKYIYLNKYLGDVKNIKVIYGPAARLRPSDVPDKYYSFNYEGIARNLSCREPNQHFKPY    421 - 490
LKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALNPSERKYCGSGFHGSDNVFSNMQALFVGYGPGFKHGIE    491 - 560
ADTFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVYTPKHPKEVHPLVQCPFTRNPRDNLGCSCNP    561 - 630
SILPIEDFQTQFNLTVAEEKIIKHETLPYGRPRVLQKENTICLLSQHQFMSGYSQDILMPLWTSYTVDRN    631 - 700
DSFSTEDFSNCLYQDFRIPLSPVHKCSFYKNNTKVSYGFLSPPQLNKNSSGIYSEALLTTNIVPMYQSFQ    701 - 770
VIWRYFHDTLLRKYAEERNGVNVVSGPVFDFDYDGRCDSLENLRQKRRVIRNQEILIPTHFFIVLTSCKD    771 - 840
TSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSFYQQRKEPVSD    841 - 910
ILKLKTHLPTFSQED                                                           911 - 925
//

Text Mined References (214)

PMID Year Title