Property Summary

NCBI Gene PubMed Count 14
Grant Count 133
R01 Count 77
Funding $34,944,607.33
PubMed Score 972.83
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession P22392 A8MWA3 Q1WM23 Q6LCT6 NDK B
Symbols NMELV
NM23-LV

Gene

PDB

1NSK   1NUE   3BBB   3BBC   3BBF  

 GWAS Trait (1)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20101217 Plakoglobin has a role in regulating the metastasis suppressor activity of Nm23.

AA Sequence

MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS      1 - 70
GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELV     71 - 140
DYKSCAHDWVYE                                                              141 - 152
//

Text Mined References (22)

PMID Year Title
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20946858 2010 Reversible histidine phosphorylation in mammalian cells: a teeter-totter formed by nucleoside diphosphate kinase and protein histidine phosphatase 1.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20101217 2010 Plakoglobin interacts with and increases the protein levels of metastasis suppressor Nm23-H2 and regulates the expression of Nm23-H1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314099 2007 NM23-H1 tumor suppressor physically interacts with serine-threonine kinase receptor-associated protein, a transforming growth factor-beta (TGF-beta) receptor-interacting protein, and negatively regulates TGF-beta signaling.
16862176 2007 Novel roles of NM23 proteins in skin homeostasis, repair and disease.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...