Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1033.03
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (2)

AA Sequence

MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS      1 - 70
GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELV     71 - 140
DYKSCAHDWVYE                                                              141 - 152
//

Text Mined References (22)

PMID Year Title