Property Summary

NCBI Gene PubMed Count 56
PubMed Score 279.10
PubTator Score 85.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Gene RIF (40)

AA Sequence

MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGK      1 - 70
EACALDTVGWVQRHRKMLRHCPSKRK                                                 71 - 96
//

Text Mined References (57)

PMID Year Title