Property Summary

NCBI Gene PubMed Count 56
Grant Count 39
R01 Count 26
Funding $3,799,341.79
PubMed Score 261.26
PubTator Score 85.69

Knowledge Summary

Patent

No data available

Gene RIF (38)

PMID Text
26722451 was to evaluate the possible association between CCL1 rs2072069 G/A or/and TLR2 rs3804099 T/C (T597C) polymorphisms and pulmonary tuberculosis (PTB) or/and tuberculous meningitis (TBM) in a sample of the Chinese adult population
26548923 The results of the present study demonstrated that GAS5 was able to suppress bladder cancer cell proliferation, at least partially, by suppressing the expression of CCL1.
23878309 These data identify a novel function for CCL1-CCR8 in metastasis and lymph node LECs as a critical checkpoint for the entry of metastases into the lymph nodes.
23811304 CCL1-CCR8 interaction may play a critical role in lymphocytic recruitment in IgG4-related sclerosing cholangitis and type 1 autoimmune pancreatitis, leading to duct-centred inflammation and obliterative phlebitis.
23333304 HIV-1 Vif downregulates the expression of chemokine (C-C motif) ligand 1 (CCL1) in Vif-expression T cells
22948508 CCL1, CCL26, and IgE may be associated with pruritus in cutaneous T-cell lymphoma.
22479563 C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity
22147355 There was a borderline association between a single nucleotide polymorphism located within the CCL1 gene and predisposition to tuberculosis using a singlepoint analysis
21849907 ACEI is effective in downregulating LPS-induced TNF-alpha, I-309, and IP-10, which play important roles in the pathogenesis of inflammation
20503287 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGK      1 - 70
EACALDTVGWVQRHRKMLRHCPSKRK                                                 71 - 96
//

Text Mined References (57)

PMID Year Title
26722451 2015 Genetic polymorphisms of CCL1 rs2072069 G/A and TLR2 rs3804099 T/C in pulmonary or meningeal tuberculosis patients.
26548923 2016 Long non?coding RNA?GAS5 acts as a tumor suppressor in bladder transitional cell carcinoma via regulation of chemokine (C?C motif) ligand 1 expression.
23878309 2013 Tumor cell entry into the lymph node is controlled by CCL1 chemokine expressed by lymph node lymphatic sinuses.
23811304 2013 Possible involvement of CCL1-CCR8 interaction in lymphocytic recruitment in IgG4-related sclerosing cholangitis.
22948508 2013 Association of nerve growth factor, chemokine (C-C motif) ligands and immunoglobulin E with pruritus in cutaneous T-cell lymphoma.
22479563 2012 C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22147355 2011 Tuberculosis susceptibility genes in the chemokine cluster region of chromosome 17 in Hong Kong Chinese.
21849907 2011 Suppressive effects of imidapril on Th1- and Th2-related chemokines in monocytes.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
More...