Property Summary

NCBI Gene PubMed Count 89
PubMed Score 472.30
PubTator Score 303.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Neurodegenerative Disorders 79
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.9
Disease Target Count Z-score Confidence
Keshan disease 17 4.161 2.1
Cancer 2499 3.476 1.7
Vascular disease 319 3.13 1.6

Expression

  Differential Expression (36)

Disease log2 FC p
Endometriosis -1.487 3.9e-02
acute quadriplegic myopathy 1.992 2.0e-08
adrenocortical carcinoma -2.239 1.4e-03
astrocytoma 1.500 2.0e-06
Astrocytoma, Pilocytic 2.600 7.2e-07
autosomal dominant Emery-Dreifuss muscul... 1.334 7.3e-04
breast carcinoma -1.900 4.5e-03
colon cancer -2.200 1.3e-02
diabetes mellitus -1.200 1.7e-02
ductal carcinoma in situ -3.200 1.9e-04
esophageal adenocarcinoma -2.500 1.8e-02
fibroadenoma -3.200 3.7e-03
gastric cancer -1.400 1.9e-02
glioblastoma 2.100 5.0e-03
hepatocellular carcinoma -1.100 4.0e-03
intraductal papillary-mucinous adenoma (... -3.700 9.2e-06
intraductal papillary-mucinous carcinoma... -4.000 2.0e-04
intraductal papillary-mucinous neoplasm ... -4.700 1.1e-04
invasive ductal carcinoma -1.079 4.2e-02
juvenile dermatomyositis 1.140 2.5e-08
limb girdle muscular dystrophy 2A 1.053 1.1e-05
lung adenocarcinoma -1.600 1.8e-13
lung cancer -3.200 2.1e-05
malignant mesothelioma 7.600 1.9e-09
non-small cell lung cancer -2.995 1.0e-26
oligodendroglioma 1.300 3.6e-05
osteosarcoma 1.174 2.7e-02
ovarian cancer 1.800 1.6e-02
pancreatic cancer -1.100 4.6e-02
pancreatic carcinoma -1.100 4.6e-02
pancreatic ductal adenocarcinoma liver m... -3.045 4.6e-02
pediatric high grade glioma 1.500 5.3e-03
posterior fossa group A ependymoma 1.300 4.7e-02
primitive neuroectodermal tumor 1.300 1.3e-02
psoriasis 1.800 4.1e-04
tuberculosis -1.900 5.4e-05

Gene RIF (75)

AA Sequence

MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVA      1 - 70
SYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDV     71 - 140
NGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMD    141 - 210
ILSYMRRQAALGVKRK                                                          211 - 226
//

Text Mined References (90)

PMID Year Title