Property Summary

NCBI Gene PubMed Count 84
Grant Count 56
R01 Count 28
Funding $7,541,012.15
PubMed Score 454.78
PubTator Score 303.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (70)

PMID Text
26662676 GPX1*Pro198Leu AND GPX3 rs2070593 as genetic risk markers for Italian asthmatic patients
26612412 A three-way interaction among maternal and fetal variants in BHMT2, GSTP1 and GPX3 contribute to congenital heart defects
26261521 GPX3 hypermethylation is frequent in chronic myeloid leukemia and is negatively associated with its expression.
26112936 GPX1, GPX3, and GPX4 genes may play a role in clear cell renal cell carcinoma cancerogenesis.
26045745 Reduced GPX3 expression is associated with favorable/intermediate karyotypes but not with survival in de novo acute myeloid leukemia patients.
25929866 GPX3 is frequently methylated in human papillary thyroid cancer and the expression of GPX3 was regulated by promoter region methylation
25445749 Our results suggest that promoter methylation may be a mechanism for inactivation of GPX3, possibly leading to subsequent carcinogenesis and progression of HCC
25333265 GPx3 is a tumor suppressor gene in HCC.
25126700 The T allele of -861A/T in GPX3 gene is a risk allele for the ischemic stroke phenotype.
24926085 APOA1 and GPX3 mRNA levels on qRT-PCR effectively differentiate ovarian from breast carcinoma.
More...

AA Sequence

MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVA      1 - 70
SYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDV     71 - 140
NGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMD    141 - 210
ILSYMRRQAALGVKRK                                                          211 - 226
//

Text Mined References (85)

PMID Year Title
26662676 2016 GPX1*Pro198Leu AND GPX3 rs2070593 as genetic risk markers for Italian asthmatic patients.
26612412 2016 A Three-Way Interaction among Maternal and Fetal Variants Contributing to Congenital Heart Defects.
26261521 2015 GPX3 promoter is methylated in chronic myeloid leukemia.
26112936 2015 Aberrant expression of selenium-containing glutathione peroxidases in clear cell renal cell carcinomas.
26045745 2015 Down-regulation of GPX3 is associated with favorable/intermediate karyotypes in de novo acute myeloid leukemia.
25929866 2015 Silencing GPX3 Expression Promotes Tumor Metastasis in Human Thyroid Cancer.
25445749 2015 Methylation of promoter and expression silencing of GPX3 gene in hepatocellular carcinoma tissue.
25416956 2014 A proteome-scale map of the human interactome network.
25333265 2014 Clinical significance and therapeutic value of glutathione peroxidase 3 (GPx3) in hepatocellular carcinoma.
25126700 2014 Screening of the GPX3 gene identifies the "T" allele of the SNP -861A/T as a risk for ischemic stroke in young Asian Indians.
More...