Property Summary

NCBI Gene PubMed Count 58
Grant Count 22
R01 Count 16
Funding $1,773,797.02
PubMed Score 144.48
PubTator Score 122.18

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26432019 recent findings put UBA1 at the center of cellular homeostasis and neurodegeneration [review]
25768649 Conjugation of the ubiquitin activating enzyme UBE1 with the ubiquitin-like modifier FAT10 targets it for proteasomal degradation
25209502 We expressed and purified the N-terminal domains of human E1 and determined their crystal structures, which contain inactive adenylation domain (IAD) and the first catalytic cysteine half-domain (FCCH)
25207809 A ubiquitin shuttle DC-UbP reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
25138535 Ubiquitin-activating enzyme is necessary for 17beta-estradiol-induced breast cancer cell proliferation and migration.
22999844 Diminished ubiquitylation phenotype observed in enteropathogenic Escherichia coli infected cells corresponds to a strong reduction in the abundance of both Ube1 and Uba6.
22456334 UBA1 knockdown impairs formation of ubiquitin conjugates at DNA double-strand breaks.
22370482 Decrease in free ubiquitin levels under stress allows NEDD8 to be conjugated through Ube1.
22279528 Data show that largazole and ester/keto analogs inhibit ubiquitin E1 activation.
22190034 HIV-1 IN is identified to have a physical interaction with ubiquitin-like modifier activating enzyme 1 (UBA1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRL      1 - 70
QTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNS     71 - 140
YVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTD    141 - 210
SNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDT    211 - 280
SNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPR    281 - 350
NEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPI    351 - 420
MQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMI    421 - 490
GLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIY    491 - 560
DDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIP    561 - 630
ICTLKNFPNAIEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRP    631 - 700
QTWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAAN    701 - 770
LFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLP    771 - 840
GFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELY    841 - 910
KVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFK    911 - 980
TEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEV    981 - 1050
PYVRYTIR                                                                 1051 - 1058
//

Text Mined References (74)

PMID Year Title
26432019 2015 UBA1: At the Crossroads of Ubiquitin Homeostasis and Neurodegeneration.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25768649 2015 Conjugation of the ubiquitin activating enzyme UBE1 with the ubiquitin-like modifier FAT10 targets it for proteasomal degradation.
25209502 2014 Expression, purification, and crystal structure of N-terminal domains of human ubiquitin-activating enzyme (E1).
25207809 2014 A ubiquitin shuttle DC-UbP/UBTD2 reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
25138535 2014 Ubiquitin-activating enzyme is necessary for 17?-estradiol-induced breast cancer cell proliferation and migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23518311 2013 Clinical and neuropathological features of X-linked spinal muscular atrophy (SMAX2) associated with a novel mutation in the UBA1 gene.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...