Property Summary

NCBI Gene PubMed Count 58
PubMed Score 154.15
PubTator Score 122.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Muscular atrophy 71 3.663 1.8

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 2.000 2.8e-03
atypical teratoid / rhabdoid tumor 1.500 1.1e-09
breast carcinoma 1.400 2.3e-02
glioblastoma 1.300 3.0e-05
intraductal papillary-mucinous adenoma (... 1.100 3.8e-03
intraductal papillary-mucinous carcinoma... 1.400 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.900 3.5e-03
medulloblastoma, large-cell 1.200 2.8e-05
osteosarcoma -1.354 1.7e-05
ovarian cancer -1.100 1.3e-03
psoriasis -1.300 3.0e-03
Rheumatoid arthritis -1.400 1.1e-02

Gene RIF (21)

AA Sequence

MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRL      1 - 70
QTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNS     71 - 140
YVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTD    141 - 210
SNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDT    211 - 280
SNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPR    281 - 350
NEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPI    351 - 420
MQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMI    421 - 490
GLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIY    491 - 560
DDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIP    561 - 630
ICTLKNFPNAIEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRP    631 - 700
QTWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAAN    701 - 770
LFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLP    771 - 840
GFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELY    841 - 910
KVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFK    911 - 980
TEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEV    981 - 1050
PYVRYTIR                                                                 1051 - 1058
//

Text Mined References (74)

PMID Year Title