Property Summary

NCBI Gene PubMed Count 76
PubMed Score 62.89
PubTator Score 160.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Anemia 365 0.0 3.0
Disease Target Count
Sickle Cell Anemia 53

Protein-protein Interaction (1)

Gene RIF (41)

AA Sequence

MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIK      1 - 70
EEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNVSLALHRCCVELLHNEALIRH     71 - 140
LNATSFDVVLTDPVNLCGAVLAKYLSIPAVFFWRYIPCDLDFKGTQCPNPSSYIPKLLTTNSDHMTFLQR    141 - 210
VKNMLYPLALSYICHTFSAPYASLASELFQREVSVVDLVSYASVWLFRGDFVMDYPRPIMPNMVFIGGIN    211 - 280
CANGKPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNT    281 - 350
ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT    351 - 420
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSL    421 - 490
DVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                              491 - 534
//

Text Mined References (83)

PMID Year Title