Property Summary

NCBI Gene PubMed Count 71
Grant Count 5
R01 Count 3
Funding $385,994.67
PubMed Score 59.79
PubTator Score 160.96

Knowledge Summary

Patent

No data available

Synonym

Accession P22310 B2R937 B8K288 Q5DT00 UDPGT 1-4
Symbols UDPGT
UGT1D
UGT-1D
UGT1.4
HUG-BR2
UGT1-04
UGT1A4S
UDPGT 1-4

Gene

PANTHER Protein Class (2)

Gene RIF (36)

PMID Text
26303110 Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C > T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children
26176234 This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen
26010150 in tumor liver microsomes from HCC patients, either V(max) (maximum reaction rate, R(max) for UGT1A1) or clearance rates (V(max)/K(m), Clint) of UGT1A, UGT1A1, UGT1A4, UGT1A9 and UGT2B7 were lower than those in the adjacent normal liver microsomes
24917585 The association between the UGT1A4 promoter and coding region SNPs and the glucuronidation rates of Tam.
24820767 Correlation of the UGT1A4 gene polymorphism with serum concentration and therapeutic efficacy of lamotrigine in Han Chinese of Northern China
24641623 Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3.
23611809 the substrate specificity of UGT2B10, highlighting its preference for tertiary amines with higher affinities and clearance values than those of UGT1A4 and UGT1A3.
23277392 Present results could be helpful to improve the use of UGT1A4 drug substrates in order to adjust them to the ethnic background of a given population, specifically for Hispanics.
22713701 Polymorphic glucuronidation of olanzapine by uridine diphosphate glucuronosyltransferase 1A4 (UGT1A4) was investigated retrospectively in patient samples
22367373 study to determine the allelic frequency of two most common defective alleles: UGT1A4*2 and UGT1A4*3 in a Jordanian population
More...

AA Sequence

MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIK      1 - 70
EEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNVSLALHRCCVELLHNEALIRH     71 - 140
LNATSFDVVLTDPVNLCGAVLAKYLSIPAVFFWRYIPCDLDFKGTQCPNPSSYIPKLLTTNSDHMTFLQR    141 - 210
VKNMLYPLALSYICHTFSAPYASLASELFQREVSVVDLVSYASVWLFRGDFVMDYPRPIMPNMVFIGGIN    211 - 280
CANGKPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNT    281 - 350
ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT    351 - 420
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSL    421 - 490
DVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                              491 - 534
//

Text Mined References (78)

PMID Year Title
26303110 2015 Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C?>?T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children.
26176234 2015 Impacts of the Glucuronidase Genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 on Tamoxifen Metabolism in Breast Cancer Patients.
26010150 2015 Drug-Metabolizing Activity, Protein and Gene Expression of UDP-Glucuronosyltransferases Are Significantly Altered in Hepatocellular Carcinoma Patients.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24917585 2014 A potential role for human UDP-glucuronosyltransferase 1A4 promoter single nucleotide polymorphisms in the pharmacogenomics of tamoxifen and its derivatives.
24820767 2014 Correlation of the UGT1A4 gene polymorphism with serum concentration and therapeutic efficacy of lamotrigine in Han Chinese of Northern China.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24641623 2014 Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3: metabolite structure, kinetics, inducibility, and interindividual variability.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...