Property Summary

NCBI Gene PubMed Count 576
Grant Count 138
R01 Count 90
Funding $14,697,785.01
PubMed Score 893.86
PubTator Score 1317.79

Knowledge Summary

Patent

No data available

Synonym

Accession P22309 A6NJC3 B8K286 UDPGT 1-1
Symbols GNT1
UGT1
UDPGT
UGT1A
HUG-BR1
BILIQTL1
UDPGT 1-1

Gene

PANTHER Protein Class (2)

Gene RIF (602)

PMID Text
27264814 compound UGT1A1 gene mutation probably accounts for the disease in the patient manifesting persistent mild unconjugated hyperbilirubinemia
26857783 UGT1A1*6 and UGT1A1*28 polymorphisms were associated with severe neutropenia
26773202 This review presents an overview of the clinical effects of UGT1A1 polymorphisms on the pharmacology of UGT1A1 substrates, with a special focus on the novel histone deacetylase inhibitor belinostat. [review]
26751466 smoking or alcohol consumption and the rs4148323 G allele of UGT1A1 act synergistically to increase the risk of laryngeal cancer
26716871 single nucleotide variations in Indian subjects with unconjugated hyperbilirubinemia
26697581 Case Report: mutations in UGT1A1 gene that resulted in residual enzymatic activity in related Iranian subjects with Crigler-Najjar syndrome type I (CN-1) and type II.
26645279 UGT1A1 Polymorphisms Predict Recurrence of Non-Muscle-Invasive Bladder Cancer.
26628212 Strong linkage disequilibrium was observed across a 200 kb region spanning the UDP-glucuronosyltransferase family, including UGT1A1, an enzyme known to metabolise bilirubin.
26494856 This trial does not support the use of the intensive treatment with HD-FOLFIRI plus bevacizumab combination for Metastatic Colorectal Cancer in patients with the UGTA1*1/UGT1A1*1 or UGT1A1*1/UGT1A1*28 genotype
26482555 GMP scores of cancerous tissue combined with UGT1A1 genotyping of blood samples may serve as highly potent markers for predicting the efficacy of NAC for individual SCC patients.
More...

AA Sequence

MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRD      1 - 70
GAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASL     71 - 140
AESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSDHMTFLQRV    141 - 210
KNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINC    211 - 280
LHQNPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTI    281 - 350
LVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS    351 - 420
EDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLD    421 - 490
VIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                               491 - 533
//

Text Mined References (581)

PMID Year Title
27264814 2016 [Genetic analysis of a child affected with Crigler-Najjar syndrome type II].
26857783 2016 Effects of UGT1A1*6, UGT1A1*28, and ABCB1-3435C>T polymorphisms on irinotecan induced toxicity in Chinese cancer patients.
26773202 2016 UGT genotyping in belinostat dosing.
26751466 2016 Association between UGT1A1 Polymorphism and Risk of Laryngeal Squamous Cell Carcinoma.
26716871 2015 Identification of Promotor and Exonic Variations, and Functional Characterization of a Splice Site Mutation in Indian Patients with Unconjugated Hyperbilirubinemia.
26697581 2015 Two Different UGT1A1 Mutations causing Crigler-Najjar Syndrome types I and II in an Iranian Family.
26645279 2016 Phase II Drug-Metabolizing Polymorphisms and Smoking Predict Recurrence of Non-Muscle-Invasive Bladder Cancer: A Gene-Smoking Interaction.
26628212 2015 Serum bilirubin concentration is modified by UGT1A1 haplotypes and influences risk of type-2 diabetes in the Norfolk Island genetic isolate.
26494856 2015 High-Dose FOLFIRI plus Bevacizumab in the Treatment of Metastatic Colorectal Cancer Patients with Two Different UGT1A1 Genotypes: FFCD 0504 Study.
26482555 2015 Genomic profile predicts the efficacy of neoadjuvant chemotherapy for cervical cancer patients.
More...