Property Summary

NCBI Gene PubMed Count 612
PubMed Score 932.54
PubTator Score 1317.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

Gene RIF (638)

AA Sequence

MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRD      1 - 70
GAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASL     71 - 140
AESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSDHMTFLQRV    141 - 210
KNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINC    211 - 280
LHQNPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTI    281 - 350
LVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS    351 - 420
EDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLD    421 - 490
VIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                               491 - 533
//

Text Mined References (617)

PMID Year Title