Property Summary

NCBI Gene PubMed Count 55
Grant Count 59
R01 Count 51
Funding $6,649,797.89
PubMed Score 497.34
PubTator Score 173.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession P22307 A6NM69 B4DGJ9 B4DHP6 C9JC79 D3DQ37 E1B6W5 F2Z3J1 Q15432 Q16622 Q5VVZ1 Q6NXF4 Q99430 NSL-TP
Symbols NLTP
SCPX
SCP-2
SCP-X
NSL-TP
SCP-CHI

Gene

PDB

2C0L   1QND  

Gene RIF (17)

PMID Text
24510313 We conclude that SCP-2 is a low affinity binding protein for arachidonylethanolamine that can facilitate its cellular uptake but does not contribute significantly to intracellular sequestration of AEA.
21375735 The Peroxisomal targeting signal 1 in Scp2 is autonomous and is essential for binding to pex5.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20677014 Statistical analysis indicated that six genes, NFATC2, SCP2, CACNA1C, TCRA, POLE, and FAM3D, were associated with narcolepsy.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20656919 cellular SCP-2 not only binds and translocates cholesterol but also cholesterol hydroperoxides, thus expanding their redox toxicity and signaling ranges under oxidative stress conditions
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19020914 Results describe the dynamical effect of sterol carrier protein-2 (SCP-2) interacting between aqueous dispersions of dehydroergosterol monohydrate microcrystal donors and acceptors.
More...

AA Sequence

MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDST      1 - 70
CGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPT     71 - 140
DKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVM    141 - 210
ASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDM    211 - 280
SKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGL    281 - 350
ISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE    351 - 420
AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSD    421 - 490
KKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL                 491 - 547
//

Text Mined References (63)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24510313 2014 Sterol carrier protein-2: binding protein for endocannabinoids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21375735 2011 The Peroxisomal Targeting Signal 1 in sterol carrier protein 2 is autonomous and essential for receptor recognition.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
More...