Property Summary

Ligand Count 1
NCBI Gene PubMed Count 58
PubMed Score 485.39
PubTator Score 173.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.300 2.0e-02
Astrocytoma, Pilocytic 1.100 2.8e-06
Down syndrome 1.300 4.8e-04
ependymoma 1.100 3.7e-12
glioblastoma 1.700 4.4e-04
hereditary spastic paraplegia -1.181 1.4e-03
lung adenocarcinoma 1.264 8.4e-06
malignant mesothelioma -1.600 2.0e-07
Multiple myeloma 1.833 3.5e-04
osteosarcoma 1.475 5.2e-04
ovarian cancer -2.300 1.8e-06
pancreatic ductal adenocarcinoma liver m... -2.867 7.9e-03
pediatric high grade glioma 1.100 4.7e-06
progressive supranuclear palsy -1.500 1.3e-02
psoriasis 1.400 4.7e-04
subependymal giant cell astrocytoma 2.199 8.9e-03
Waldenstrons macroglobulinemia 1.545 1.1e-02

Protein-protein Interaction (3)

Gene RIF (20)

AA Sequence

MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDST      1 - 70
CGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPT     71 - 140
DKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVM    141 - 210
ASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDM    211 - 280
SKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGL    281 - 350
ISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE    351 - 420
AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSD    421 - 490
KKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL                 491 - 547
//

Text Mined References (66)

PMID Year Title