Property Summary

NCBI Gene PubMed Count 177
Grant Count 572
R01 Count 278
Funding $116,472,748.29
PubMed Score 2343.40
PubTator Score 4664.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.814 0.000
posterior fossa group A ependymoma -1.800 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
sonic hedgehog group medulloblastoma -1.700 0.005
pilocytic astrocytoma 1.200 0.014
pituitary cancer 1.500 0.000
dermatomyositis -1.300 0.003

Synonym

Accession P22303 A4D2E2 B7ZKZ0 D6W5X7 Q16169 Q29S23 Q2M324 Q504V3 Q53F46 Q86TM9 Q86YX9 Q9BXP7 AChE
Symbols YT
ACEE
ARACHE
N-ACHE

Gene

PANTHER Protein Class (2)

PDB

1B41   1F8U   1PUV   1PUW   1VZJ   2CLJ   2X8B   3LII   4BDT   4EY4   4EY5   4EY6   4EY7   4EY8   4M0E   4M0F   4PQE   5FOQ   5FPQ   5HF5   5HF6   5HF8   5HF9   5HFA  

 GWAS Trait (1)

Gene RIF (138)

PMID Text
26494253 Report acetylcholinesterase kinetics using fluorogenic probe for the investigation of free thiols.
26369587 Data suggest membranes of erythrocytes of patients with chronic obstructive pulmonary disease exhibit the following changes: increase in acetylcholinesterase; decrease in total ATPases and Na+/K+-ATPases; increase in lipid peroxidation/oxidative stress.
26299326 Phosphorylated p38, DNMT1 and AChE were aberrantly expressed in a subset of hepatocellular carcinoma tumors.
26210933 Report reactivation kinetics of a large series of bispyridinium oximes with organophosphate-inhibited human acetylcholinesterase.
26202430 Data suggest cholinesterase inhibitors with high potency have proper conformation in active site of ACHE and interact with key residues (Trp84, Phe330 at catalytic anionic site; Trp279 at peripheral anionic site; Gly118, Gly119, Ala201 at oxyanion hole.
26200596 Case Report: repetitive obidoxime treatment induced increase of red blood cell acetylcholinesterase activity even in a late phase of a severe methamidophos poisoning.
26051873 PRX-105 is a plant-derived recombinant version of the human 'read-through' acetylcholinesterase splice variant (AChE-R) which may be used for treatment/prevention of organophosphate poisoning.
26002584 These results suggest that the low AChE activity observed in larynx squamous cell carcinoma may be useful for predicting the outcome of patients.
25956553 Low AChE activity in head and neck squamous cell carcinoma can be used to predict survival in patients with head and neck cancer.
25919665 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
More...

AA Sequence

MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAE      1 - 70
PPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPT     71 - 140
SPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLA    141 - 210
LQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRAT    211 - 280
QLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG    281 - 350
DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE    351 - 420
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL    421 - 490
DPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQAC    491 - 560
AFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL                    561 - 614
//

Text Mined References (183)

PMID Year Title
26494253 2016 A novel fluorogenic probe for the investigation of free thiols: Application to kinetic measurements of acetylcholinesterase activity.
26369587 2015 Oxidative stress and damage to erythrocytes in patients with chronic obstructive pulmonary disease--changes in ATPase and acetylcholinesterase activity.
26299326 2015 Anticancer drugs induce hypomethylation of the acetylcholinesterase promoter via a phosphorylated-p38-DNMT1-AChE pathway in apoptotic hepatocellular carcinoma cells.
26210933 2016 Investigation of the reactivation kinetics of a large series of bispyridinium oximes with organophosphate-inhibited human acetylcholinesterase.
26202430 2015 Development of 3D-QSAR Model for Acetylcholinesterase Inhibitors Using a Combination of Fingerprint, Molecular Docking, and Structure-Based Pharmacophore Approaches.
26200596 2016 Repetitive obidoxime treatment induced increase of red blood cell acetylcholinesterase activity even in a late phase of a severe methamidophos poisoning: A case report.
26051873 2015 Preclinical and first-in-human evaluation of PRX-105, a PEGylated, plant-derived, recombinant human acetylcholinesterase-R.
26002584 2015 Unbalanced acetylcholinesterase activity in larynx squamous cell carcinoma.
25956553 2015 Dysregulated cholinergic network as a novel biomarker of poor prognostic in patients with head and neck squamous cell carcinoma.
25766324 2015 Readthrough acetylcholinesterase (AChE-R) and regulated necrosis: pharmacological targets for the regulation of ovarian functions?
More...