Property Summary

NCBI Gene PubMed Count 2,700
PubMed Score 12406.78
PubTator Score 8767.19

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Leishmaniasis 47 5.822 2.9
Multiple Sclerosis 540 5.642 2.8
Irritable bowel syndrome 60 3.416 1.7
Prostatitis 18 3.126 1.6
Acute kidney injury 70 0.0 0.0
Appendicitis 15 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Autistic Disorder 364 0.0 0.0
Behcet Syndrome 21 0.0 0.0
Brain Injuries 65 0.0 0.0
Burns 9 0.0 0.0
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Colitis 54 0.0 0.0
Colitis, Ulcerative 59 0.0 0.0
Crohn Disease 45 0.0 0.0
Dermatitis, Allergic Contact 67 0.0 0.0
Dermatitis, Atopic 37 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Drug Hypersensitivity 34 0.0 0.0
Entamoebiasis 6 0.0 0.0
Enterocolitis 8 0.0 0.0
Genetic Predisposition to Disease 27 0.0 0.0
Glomerulonephritis 46 0.0 0.0
Graft vs Host Disease 6 0.0 0.0
HIV Infections 102 0.0 0.0
Heat Stroke 13 0.0 0.0
Hepatitis, Autoimmune 17 0.0 0.0
Hepatolenticular Degeneration 24 0.0 0.0
Hyperalgesia 83 0.0 0.0
Hypersensitivity, Immediate 8 0.0 0.0
Ileitis 5 0.0 0.0
Inflammation 120 0.0 0.0
Inflammatory Bowel Diseases 35 0.0 0.0
Leishmaniasis, Cutaneous 8 0.0 0.0
Leishmaniasis, Visceral 13 0.0 0.0
Leukemia-Lymphoma, Adult T-Cell 30 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lupus Erythematosus, Systemic 67 0.0 0.0
Mammary Neoplasms, Experimental 154 0.0 0.0
Mucositis 29 0.0 0.0
Multiple Organ Failure 8 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Pleurisy 19 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Sepsis 24 0.0 0.0
Weight Loss 24 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.9e-23
tuberculosis 2010 5.9e-06
Disease Target Count Z-score Confidence
Herpes zoster 68 0.0 5.0
Disease Target Count Z-score Confidence
Inflammatory bowel disease 151 6.603 3.3
Hypersensitivity reaction type II disease 253 6.008 3.0
Cancer 2499 5.916 3.0
Vascular disease 319 5.849 2.9
Asthma 385 5.62 2.8
Allergic hypersensitivity disease 126 5.552 2.8
Malaria 160 5.197 2.6
Pneumonia 174 4.966 2.5
Dermatitis 157 4.948 2.5
diabetes mellitus 1728 4.915 2.5
Liver disease 237 4.9 2.4
periodontitis 293 4.833 2.4
Pancreatitis 123 4.804 2.4
Schistosomiasis 35 4.651 2.3
Kidney disease 430 4.633 2.3
Uveitis 103 4.622 2.3
Allergic rhinitis 95 4.538 2.3
Peritonitis 43 4.418 2.2
Hepatitis C 94 4.407 2.2
Influenza 142 4.386 2.2
Hypereosinophilic syndrome 71 4.316 2.2
Heart disease 306 4.304 2.2
Tetanus 68 4.251 2.1
Chagas disease 39 4.243 2.1
Paracoccidioidomycosis 12 4.237 2.1
Hepatitis B 108 4.217 2.1
Obesity 678 4.212 2.1
Leprosy 73 4.171 2.1
Primary immunodeficiency disease 54 3.957 2.0
Diarrhea 253 3.889 1.9
Filariasis 21 3.873 1.9
Gastritis 47 3.854 1.9
Brain disease 96 3.837 1.9
Kawasaki disease 28 3.8 1.9
interstitial lung disease 298 3.789 1.9
Respiratory Failure 104 3.769 1.9
Anemia 365 3.706 1.9
Toxoplasmosis 17 3.706 1.9
Candidiasis 55 3.629 1.8
Neuropathy 261 3.564 1.8
Chronic obstructive pulmonary disease 184 3.5 1.7
Dry eye syndrome 18 3.477 1.7
Dengue disease 23 3.376 1.7
Alzheimer's disease 658 3.372 1.7
Echinococcosis 26 3.342 1.7
Leukopenia 72 3.337 1.7
Keratitis 62 3.296 1.6
Bronchiolitis 18 3.278 1.6
Collagen disease 27 3.277 1.6
Aspergillosis 26 3.251 1.6
Salmonellosis 42 3.224 1.6
Toxic shock syndrome 28 3.206 1.6
Chlamydia 21 3.199 1.6
sarcoidosis 370 3.185 1.6
Ehrlichiosis 9 3.173 1.6
Thrombocytopenia 197 3.161 1.6
Common cold 69 3.158 1.6
Hyperglycemia 137 3.152 1.6
Lyme disease 26 3.144 1.6
Retinal disease 25 3.124 1.6
Listeriosis 18 3.068 1.5
Endometriosis 540 3.038 1.5
Sleeping sickness 37 3.036 1.5
Perinatal necrotizing enterocolitis 21 3.028 1.5
Mastitis 48 3.017 1.5
Brucellosis 24 3.007 1.5


  Differential Expression (2)

Disease log2 FC p
tuberculosis -2.800 5.9e-06
psoriasis 1.300 1.9e-23

Protein-protein Interaction (4)

Gene RIF (3058)

AA Sequence

QVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN                                    141 - 178

Text Mined References (2700)

PMID Year Title