Property Summary

NCBI Gene PubMed Count 2,468
PubMed Score 11514.57
PubTator Score 8767.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count Z-score Confidence
Inflammatory bowel disease 142 6.554 3.3
Hypersensitivity reaction type II disease 235 5.981 3.0
Arthritis 248 5.88 2.9
Cancer 2346 5.865 2.9
Vascular disease 281 5.758 2.9
Multiple Sclerosis 498 5.609 2.8
Asthma 349 5.569 2.8
Allergic hypersensitivity disease 123 5.504 2.8
tuberculosis 1563 5.388 2.7
Malaria 140 5.186 2.6
Pneumonia 133 4.943 2.5
Dermatitis 141 4.933 2.5
Liver disease 219 4.85 2.4
diabetes mellitus 1663 4.826 2.4
Pancreatitis 97 4.741 2.4
periodontitis 269 4.681 2.3
Schistosomiasis 38 4.63 2.3
Kidney disease 397 4.569 2.3
Uveitis 103 4.537 2.3
Allergic rhinitis 92 4.489 2.2
Hepatitis C 90 4.395 2.2
Peritonitis 37 4.371 2.2
Influenza 142 4.358 2.2
Eosinophilia 65 4.329 2.2
Paracoccidioidomycosis 11 4.293 2.1
psoriasis 6685 4.266 2.1
Heart disease 279 4.246 2.1
Tetanus 66 4.187 2.1
Hepatitis B 103 4.145 2.1
Chagas disease 34 4.125 2.1
Obesity 616 4.077 2.0
Leprosy 77 4.076 2.0
Filariasis 21 3.918 2.0
Meningitis 46 3.9 1.9
Encephalitis 54 3.862 1.9
Gastritis 44 3.823 1.9
Diarrhea 155 3.783 1.9
interstitial lung disease 292 3.778 1.9
Kawasaki disease 24 3.772 1.9
Primary immunodeficiency disease 52 3.701 1.9
Anemia 252 3.658 1.8
Candidiasis 48 3.642 1.8
Respiratory failure 30 3.583 1.8
Toxoplasmosis 16 3.575 1.8
Neuropathy 210 3.461 1.7
Toxic shock syndrome 28 3.416 1.7
Chronic obstructive pulmonary disease 147 3.361 1.7
Echinococcosis 28 3.323 1.7
Keratitis 42 3.292 1.6
Bronchiolitis 9 3.277 1.6
Alzheimer's disease 644 3.268 1.6
Leukopenia 42 3.244 1.6
Dengue disease 19 3.233 1.6
Keratoconjunctivitis sicca 19 3.203 1.6
Chlamydia 18 3.18 1.6
Aspergillosis 23 3.165 1.6
Listeriosis 17 3.149 1.6
Autoimmune Lymphoproliferative Syndrome 12 3.131 1.6
Ehrlichiosis 9 3.131 1.6
Collagen disease 25 3.124 1.6
sarcoidosis 368 3.111 1.6
Lyme disease 23 3.096 1.5
Common cold 63 3.074 1.5
Thrombocytopenia 105 3.06 1.5
Mastitis 48 3.038 1.5
Q fever 11 3.022 1.5
Hyperglycemia 120 3.021 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis -2.800 0.000
psoriasis 1.300 0.000

Synonym

Accession P22301 IL-10
Symbols CSIF
TGIF
GVHDS
IL-10
IL10A

Gene

PDB

1J7V   1Y6K   1ILK   1INR   1LK3   2H24   2ILK  

  Ortholog (11)

Gene RIF (2826)

PMID Text
27468578 Variants in the IL-10 gene may change the risk of both colon cancer and inflammatory bowel disease. The C allele at rs1800872 may be a protective factor in colon cancer and the T allele at rs3024505 may be a risk factor in IBD in a Han Chinese population.
27296261 There was an association of the polymorphism G(-1082)A of the IL-10 gene with the clinical features of Chronic Glomerulonephritis and a response to immunosuppressive therapy .
27276844 lack of association between common IL-10 promoter polymorphisms and tuberculosis susceptibility in Thai population.
27215961 IL10 polymorphisms were not associated with juvenile idiopathic arthritis.
27213791 The frequency of IL10-1082 GG genotype was higher in Age-related macular degeneration patients than in the controls.
27029120 Significant differences in distribution of genotypes and alleles of genes IL-10 and TNF-alpha in the group of patients with periodontitis and comparison group were not detected.
26987136 CA (gt) genotype of rs1800872 polymorphism of the IL10 gene is associated with multifocal atherosclerosis.
26962683 results suggest that IL10-mediated inhibition of autophagy is facilitated by the cross talk between STAT3, AKT, and mTOR; in other words, the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways.
26886630 causal role of genetically elevated IL-10 in the development of gastric cancer, especially in East Asians and for intestinal type gastric cancer [meta-analysis]
26871859 with regard to IL-10 -592C/A and IL-10 -1082G/A polymorphisms, no significant association with cardiovascular disease risk was observed in the overall and subgroup analyses
More...

AA Sequence

MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESL      1 - 70
LEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVE     71 - 140
QVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN                                    141 - 178
//

Text Mined References (2468)

PMID Year Title
27468578 2016 An Analysis of IL-10/IL-10R Genetic Factors Related to Risk of Colon Cancer and Inflammatory Bowel Disease in a Han Chinese Population.
27296261 2016 [Clinical value of TNF, IL-6, and IL-10 gene polymorphic markers in chronic glomerulonephritis].
27276844 2015 Lack of Association between IL-10 Gene Promoter Polymorphisms and Susceptible to Tuberculosis in Thai Patients.
27215961 2016 Interleukin 10 and transforming growth factor beta 1 gene polymorphisms in juvenile idiopathic arthritis.
27213791 [Cytokine gene polymorphisms in patients with age-related macular degeneration].
27029120 [ASSOCIATION OF POLYMORPHIC MARKERS IN GENES OF INNATE IMMUNITY IN PATIENTS WITH PERIODONTITIS AND INFLAMMATORY DISEASES OF UPPER RESPIRATORY TRACT].
26987136 2015 [THE RELATIONSHIP BETWEEN POLYMORPHISMS OF G-1082A AND C-592A LOCI OF THE IL10 GENE AND MULTIFOCAL ATHEROSCLEROSIS IN PATIENTS WITH ACUTE CORONARY SYNDROME WITHOUT SEGMENT ST ELEVATION].
26962683 2016 IL10 inhibits starvation-induced autophagy in hypertrophic scar fibroblasts via cross talk between the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways.
26886630 2016 A Causal Role of Genetically Elevated Circulating Interleukin-10 in the Development of Digestive Cancers: Evidence from Mendelian Randomization Analysis Based on 29,307 Subjects.
26871859 2016 Association Between 3 IL-10 Gene Polymorphisms and Cardiovascular Disease Risk: Systematic Review With Meta-Analysis and Trial Sequential Analysis.
More...