Property Summary

NCBI Gene PubMed Count 30
PubMed Score 143.71
PubTator Score 30.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.321 5.4e-07
astrocytoma 1.300 4.7e-02
atypical teratoid / rhabdoid tumor 1.100 3.0e-04
Breast cancer 1.100 3.0e-06
colon cancer 1.100 2.1e-02
ductal carcinoma in situ 1.300 1.5e-03
ependymoma 1.100 9.1e-09
glioblastoma 1.100 3.7e-06
invasive ductal carcinoma 1.700 4.6e-03
lung adenocarcinoma 1.400 1.3e-11
lung cancer 3.900 2.4e-04
lung carcinoma 1.100 2.0e-21
medulloblastoma, large-cell 1.900 8.2e-06
Multiple myeloma 1.586 6.0e-04
nasopharyngeal carcinoma 1.400 3.1e-05
non-small cell lung cancer 2.020 4.9e-31
osteosarcoma 1.289 2.5e-02
ovarian cancer 2.500 9.5e-05
sonic hedgehog group medulloblastoma 1.300 5.2e-06
Waldenstrons macroglobulinemia 1.740 1.1e-02

Gene RIF (4)

AA Sequence

MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQE      1 - 70
AGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQW     71 - 140
SEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVID    141 - 210
NDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGH    211 - 280
CEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISC    281 - 350
PPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKI    351 - 420
RECNL                                                                     421 - 425
//

Text Mined References (46)

PMID Year Title