Property Summary

NCBI Gene PubMed Count 28
PubMed Score 141.77
PubTator Score 30.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.93125219287973E-31
lung carcinoma 2844 2.03971927404962E-21
lung adenocarcinoma 2714 6.34731278451744E-12
posterior fossa group A ependymoma 1511 3.30237786944438E-11
acute quadriplegic myopathy 1157 5.399915194646E-7
Breast cancer 3099 2.95061422670918E-6
glioblastoma 5572 3.73195976855834E-6
sonic hedgehog group medulloblastoma 1482 5.24955342488279E-6
medulloblastoma, large-cell 6234 8.19084002846389E-6
atypical teratoid/rhabdoid tumor 1095 1.17973212540519E-5
nasopharyngeal carcinoma 1056 3.08391622158713E-5
ovarian cancer 8492 9.48807125295753E-5
lung cancer 4473 2.41677796288416E-4
Multiple myeloma 1328 6.02768115556451E-4
ductal carcinoma in situ 1745 0.00152970472579792
invasive ductal carcinoma 2950 0.00456071369634575
Waldenstrons macroglobulinemia 765 0.0111931944386355
colon cancer 1475 0.020928048437568
osteosarcoma 7933 0.0247282265087516
astrocytoma 1493 0.0468364939902014

Expression

  Differential Expression (20)

Synonym

Accession P22234 E9PDH9 Q68CQ5
Symbols ADE2
AIRC
PAIS
ADE2H1

Gene

PANTHER Protein Class (1)

PDB

2H31  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (4)

PMID Text
26140362 purine biosynthetic pathway enzymes PPAT and PAICS, as well as pyruvate kinase activity are increased in lung cancer
22632162 HIV-1 Tat 47-59 peptide upregulates gene expression of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS) in U-937 macrophages
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQE      1 - 70
AGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQW     71 - 140
SEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVID    141 - 210
NDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGH    211 - 280
CEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISC    281 - 350
PPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKI    351 - 420
RECNL                                                                     421 - 425
//

Text Mined References (44)

PMID Year Title
26140362 2015 Role and regulation of coordinately expressed de novo purine biosynthetic enzymes PPAT and PAICS in lung cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...