Property Summary

NCBI Gene PubMed Count 97
PubMed Score 264.80
PubTator Score 150.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
psoriasis 6685 2.03479748126794E-100
non-small cell lung cancer 2798 1.3521758859195E-23
lung adenocarcinoma 2714 1.38410684535432E-11
colon cancer 1475 1.57954601994337E-7
malignant mesothelioma 3163 2.10332693740027E-6
pancreatic cancer 2300 2.85146715864569E-6
pilocytic astrocytoma 3086 1.70915880518898E-5
ovarian cancer 8492 1.585948036366E-4
Breast cancer 3099 2.16342960644746E-4
Atopic dermatitis 944 4.0258683962431E-4
group 4 medulloblastoma 1875 9.59093918589602E-4
atypical teratoid/rhabdoid tumor 1095 0.00148363752504245
interstitial lung disease 292 0.00218912895355671
active Crohn's disease 918 0.00307033034822471
active ulcerative colitis 477 0.0080194243324217
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0111918011574663
cutaneous lupus erythematosus 1056 0.0226090576547321
primary pancreatic ductal adenocarcinoma 1271 0.0390740307972534
Disease Target Count Z-score Confidence
ulcerative colitis 2087 0.0 2.0
Disease Target Count Z-score Confidence
Hypotrichosis 29 4.682 2.3

Expression

Synonym

Accession P22223 B2R6F4 Q05DI6
Symbols CDHP
HJMD
PCAD

Gene

PANTHER Protein Class (2)

PDB

4OY9   4ZML   4ZMN   4ZMO   4ZMP   4ZMQ   4ZMT   4ZMV   4ZMW   4ZMX   4ZMY   4ZMZ  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG

 GO Function (1)

 CSPA Cell Line (1)

Gene RIF (65)

PMID Text
26299056 In patients with breast infiltrating ductal carcinoma, P-cadherin was expressed in 40.5% of cases; P-cadherin expression had a negative relationship with the overall survival
25849494 The P-cadherin structure and packing arrangement provide new and valuable information towards the complete structural characterization of the cadherin dimerization pathway.
25337260 Downregulation of P-cadherin expression appears to induce tumorigenicity in hepatocellular carcinoma.
25322858 P-cadherin is able to potentiate ligand-dependent signaling of insulin-like growth factor 1 receptor in malignant keratinocytes and epidermal growth factor receptor in dysplastic cells.
25269858 results establish a link between aberrant P-cadherin expression and hypoxic, glycolytic and acid-resistant breast cancer cells, suggesting a possible role for this marker in cancer cell metabolism
25023983 These findings indicate that HOXA9 contributes to poor outcomes in Epithelial ovarian cancer in part by promoting intraperitoneal dissemination via its induction of P-cadherin.
24636838 Positive N-cadherin and P-cadherin expression closely correlated with clinicopathological and biological behaviors, and poor-prognosis of gallbladder cancer.
24559158 The X-dimer plays a key role in the specific cell-cell adhesion mediated by human P-cadherin.
24139214 P-cadherin and vimentin could be adjunctive to the commonly used immunohistochemical surrogates for basal-like breast cancer identification
23740836 Loss of P-cadherin expression is associated with oral squamous cell carcinoma.
More...

AA Sequence

MGLPRGPLASLLLLQVCWLQCAASEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDN      1 - 70
DDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTK     71 - 140
IFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQND    141 - 210
HKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTIS    211 - 280
VISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLT    281 - 350
VTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKL    351 - 420
PTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKISYRILRDPAGWLAMDP    421 - 490
DSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPTTGTGTLLLTLIDVNDHGPVPEPRQITICNQSP    491 - 560
VRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGDTVVLSLKKFLKQDTYDVHLSLSDHGNKEQL    561 - 630
TVIRATVCDCHGHVETCPGPWKGGFILPVLGAVLALLFLLLVLLLLVRKKRKIKEPLLLPEDDTRDNVFY    631 - 700
YGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPT    701 - 770
APPYDTLLVFDYEGSGSDAASLSSLTSSASDQDQDYDYLNEWGSRFKKLADMYGGGEDD               771 - 829
//

Text Mined References (100)

PMID Year Title
26299056 2015 [Cadherins E and P expression in the molecular types of breast cancer].
25849494 2015 The X-ray structure of human P-cadherin EC1-EC2 in a closed conformation provides insight into the type I cadherin dimerization pathway.
25337260 2014 Downregulation of P-cadherin expression in hepatocellular carcinoma induces tumorigenicity.
25322858 2014 P-cadherin potentiates ligand-dependent EGFR and IGF-1R signaling in dysplastic and malignant oral keratinocytes.
25269858 2014 The basal epithelial marker P-cadherin associates with breast cancer cell populations harboring a glycolytic and acid-resistant phenotype.
25023983 2014 HOXA9 promotes homotypic and heterotypic cell interactions that facilitate ovarian cancer dissemination via its induction of P-cadherin.
24636838 2014 N-cadherin and P-cadherin are biomarkers for invasion, metastasis, and poor prognosis of gallbladder carcinomas.
24559158 2014 Identification and characterization of the X-dimer of human P-cadherin: implications for homophilic cell adhesion.
24139214 2013 P-cadherin and vimentin are useful basal markers in breast cancers.
23740836 2013 Presenilin 1/?-secretase modulates P-cadherin processing and influences cell adhesion in oral squamous cell carcinoma cell lines.
More...