Property Summary

NCBI Gene PubMed Count 106
PubMed Score 266.82
PubTator Score 150.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 3.0

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.512 3.1e-03
active ulcerative colitis 4.118 8.0e-03
Astrocytoma, Pilocytic 1.500 2.0e-05
Atopic dermatitis 1.800 4.0e-04
atypical teratoid / rhabdoid tumor 1.700 2.3e-02
Breast cancer -1.600 2.2e-04
colon cancer 1.800 3.1e-02
cutaneous lupus erythematosus 1.100 2.3e-02
group 4 medulloblastoma 1.100 9.6e-04
interstitial lung disease 2.400 2.2e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
lung adenocarcinoma 1.800 1.4e-11
malignant mesothelioma 1.300 2.1e-06
non-small cell lung cancer 3.165 1.4e-23
ovarian cancer -1.500 1.6e-04
pancreatic cancer 2.000 2.9e-06
primary pancreatic ductal adenocarcinoma 1.457 3.9e-02
psoriasis 1.500 6.6e-07

 GO Function (1)

 CSPA Cell Line (1)

PDB (14)

Gene RIF (74)

AA Sequence

MGLPRGPLASLLLLQVCWLQCAASEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDN      1 - 70
DDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTK     71 - 140
IFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQND    141 - 210
HKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTIS    211 - 280
VISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLT    281 - 350
VTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKL    351 - 420
PTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKISYRILRDPAGWLAMDP    421 - 490
DSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPTTGTGTLLLTLIDVNDHGPVPEPRQITICNQSP    491 - 560
VRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGDTVVLSLKKFLKQDTYDVHLSLSDHGNKEQL    561 - 630
TVIRATVCDCHGHVETCPGPWKGGFILPVLGAVLALLFLLLVLLLLVRKKRKIKEPLLLPEDDTRDNVFY    631 - 700
YGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPT    701 - 770
APPYDTLLVFDYEGSGSDAASLSSLTSSASDQDQDYDYLNEWGSRFKKLADMYGGGEDD               771 - 829
//

Text Mined References (109)

PMID Year Title