Property Summary

NCBI Gene PubMed Count 36
Grant Count 61
R01 Count 26
Funding $10,258,131.36
PubMed Score 171.89
PubTator Score 102.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P22102 A8K945 A8KA32 D3DSF3 D3DSF4 O14659 Q52M77
Symbols AIRS
GARS
PAIS
PGFT
PRGS
GARTF

Gene

PANTHER Protein Class (1)

PDB

1MEJ   1MEN   1MEO   1NJS   1RBM   1RBQ   1RBY   1RBZ   1RC0   1RC1   1ZLX   1ZLY   2QK4   2V9Y   4EW1   4EW2   4EW3   4ZYT   4ZYU   4ZYV   4ZYW   4ZYX   4ZYY   4ZYZ   4ZZ0   4ZZ1   4ZZ2   4ZZ3   5J9F  

Gene RIF (17)

PMID Text
25318605 most significant association was detected for GART rs8971. Compared with individuals with the TT genotype, the age- and sex-adjusted odds ratio (OR) for developing HCC was 1.44 (95% confidence interval (CI): 1.03-2.02) among those with the CC genotype
24830618 our clinical and in vitro data indicate that GART expression may be one of the causative factors for a poor prognosis in hepatocellular carcinoma.
24444710 The current results showed that GART expression was associated with glioma grade and that high GART protein expression might be related to poor outcome.
23869564 High-resolution structural data for GART (transformylase domain; purN) reveal new binding mode for lipophilic diastereoisomer inhibitors of GART, folate analogs with anti-leukemic activity.
22931243 Using the SNaPshot assay, evidence presented for allelic nondisjunction at rs363506 in the GRIK1 gene and rs2834235 and rs7283354 in the GARS-AIRS-GART gene in Down syndrome in India.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20631005 GART has an approximate seesaw geometry where terminal enzyme units display high mobility owing to flexible linker segments.
19936946 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19301155 Performed phylogenetic analysis and report that murine, bovine and chimpanzee sequences are the nearest neighbors of human GARS-AIRS-GART and that endo-duplication of the AIRS protein is restricted to insect orthologs.
More...

AA Sequence

MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFV      1 - 70
VVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSA     71 - 140
DFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVA    141 - 210
PMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLT    211 - 280
KNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLDGLLCTSLPVWLENHTALTVVMASKGYPGDYTK    281 - 350
GVEITGFPEAQALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKD    351 - 420
VGFRAIAFLQQPRSLTYKESGVDIAAGNMLVKKIQPLAKATSRSGCKVDLGGFAGLFDLKAAGFKDPLLA    421 - 490
SGTDGVGTKLKIAQLCNKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSCGKLDLSVTEAVVAGIAKACG    491 - 560
KAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLPHLERITEGDVVVGIASSGLHSNGFSLVRKI    561 - 630
VAKSSLQYSSPAPDGCGDQTLGDLLLTPTRIYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGV    631 - 700
DLDAQTWRIPRVFSWLQQEGHLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARA    701 - 770
EGSPRVKVKNLIESMQINGSVLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV    771 - 840
ISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGK    841 - 910
MLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAE    911 - 980
HKIFPAALQLVASGTVQLGENGKICWVKEE                                            981 - 1010
//

Text Mined References (42)

PMID Year Title
25318605 2015 Genetic variations in the one-carbon metabolism pathway genes and susceptibility to hepatocellular carcinoma risk: a case-control study.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24830618 2014 Increased expression of glycinamide ribonucleotide transformylase is associated with a poor prognosis in hepatocellular carcinoma, and it promotes liver cancer cell proliferation.
24444710 2014 Glycinamide ribonucleotide formyl transferase is frequently overexpressed in glioma and critically regulates the proliferation of glioma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23869564 2013 Biological and structural evaluation of 10R- and 10S-methylthio-DDACTHF reveals a new role for sulfur in inhibition of glycinamide ribonucleotide transformylase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22931243 2012 SNaPshot Assay in Quantitative Detection of Allelic Nondisjunction in Down Syndrome.
21269460 2011 Initial characterization of the human central proteome.
More...