Property Summary

Ligand Count 49
NCBI Gene PubMed Count 37
PubMed Score 181.22
PubTator Score 102.69

Knowledge Summary


No data available


  Disease (6)


  Differential Expression (28)

Disease log2 FC p
acute quadriplegic myopathy 1.626 1.0e-10
adult high grade glioma 1.100 3.8e-03
astrocytic glioma 2.200 4.7e-03
Astrocytoma, Pilocytic 1.100 8.8e-06
atypical teratoid / rhabdoid tumor 1.300 2.5e-07
Breast cancer 2.800 4.0e-02
colon cancer 1.400 2.1e-02
ependymoma 2.400 1.9e-02
Gaucher disease type 1 -1.300 8.3e-03
glioblastoma 1.400 1.7e-07
group 3 medulloblastoma 1.600 6.1e-06
hepatocellular carcinoma 1.100 3.6e-05
intraductal papillary-mucinous carcinoma... 1.200 5.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.8e-02
lung adenocarcinoma 1.600 4.4e-20
lung cancer 1.700 2.6e-04
malignant mesothelioma 1.200 3.0e-06
medulloblastoma, large-cell 1.400 4.5e-05
nasopharyngeal carcinoma 1.100 4.3e-04
non-small cell lung cancer 1.285 3.5e-16
oligodendroglioma 1.100 7.6e-03
osteosarcoma 1.785 6.6e-05
ovarian cancer -1.900 1.1e-09
pancreatic cancer 1.600 9.6e-03
primary pancreatic ductal adenocarcinoma 1.884 3.2e-03
primitive neuroectodermal tumor 1.100 3.2e-04
psoriasis 1.100 7.8e-04
tuberculosis -1.200 1.6e-04

Gene RIF (20)

AA Sequence

HKIFPAALQLVASGTVQLGENGKICWVKEE                                            981 - 1010

Text Mined References (43)

PMID Year Title