Property Summary

NCBI Gene PubMed Count 23
Grant Count 86
R01 Count 56
Funding $12,462,946.45
PubMed Score 15.42
PubTator Score 75.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P22090 A8K9V4
Symbols S4
RPS4Y

Gene

PDB

5AJ0   5FLX  

Gene RIF (2)

PMID Text
25275262 DLG1, XIST, DDX3Y and RPS4Y1 genes can classify samples into different group clearly, and they are regarded as high confidence distinct gene biomarkers of Parkinson disease.
23225889 In a CD4 single-positive T cell clone (or the line from which clones were derived) RPS4Y was identified as the gene encoding an HLA-DRDR7-restricted HY epitope.

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFI      1 - 70
KIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLV     71 - 140
THDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHV    141 - 210
KDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG                     211 - 263
//

Text Mined References (25)

PMID Year Title
25275262 2014 Identifying distinct candidate genes for early Parkinson's disease by analysis of gene expression in whole blood.
23225889 2013 Isolation of human CD4/CD8 double-positive, graft-versus-host disease-protective, minor histocompatibility antigen-specific regulatory T cells and of a novel HLA-DR7-restricted HY-specific CD4 clone.
22708584 2012 Primer-BLAST: a tool to design target-specific primers for polymerase chain reaction.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660691 2004 Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches.
More...