Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.30
PubTator Score 75.54

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFI      1 - 70
KIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLV     71 - 140
THDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHV    141 - 210
KDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG                     211 - 263
//

Text Mined References (26)

PMID Year Title