Property Summary

NCBI Gene PubMed Count 51
Grant Count 136
R01 Count 68
Funding $22,453,955.27
PubMed Score 1580.16
PubTator Score 75.80

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P22087 B5BUE8 O75259 Q6IAT5 Q9UPI6
Symbols FIB
FLRN
RNU3IP1

Gene

FBL

PDB

2IPX  

Gene RIF (9)

PMID Text
24029231 FBL overexpression contributes to tumorigenesis and is associated with poor survival in patients with breast cancer.
22909121 NS1 protein of the human H3N2 virus interacts primarily via the C-terminal NLS2/NoLS and to a minor extent via the N-terminal NLS1 with the main nucleolar proteins, nucleolin, B23 and fibrillarin.
21536856 p32 is a new rRNA maturation factor involved in the remodeling from pre-90S particles to pre-40S and pre-60S particles that requires the exchange of FBL for Nop52.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19331828 Data demonstrate that fibrillarin and Nop56 directly interact in vivo, and that this interaction is indispensable for the association of both proteins with the box C/D snoRNPs.
18292223 Evidence that BIG1 and nucleolin, but not fibrillarin, can be present with p62 at the nuclear envelope confirms the presence of BIG1 and nucleolin in dynamic molecular complexes that change in composition while moving through nuclei
17603021 Our data suggest that fibrillarin would play a critical role in the maintenance of nuclear shape and cellular growth.
17461797 Increased levels of exogenous BRAG2 in nucleoli result in redistribution of FBL to the nucleolar periphery.

AA Sequence

MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNR      1 - 70
GRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPF     71 - 140
RSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNI    141 - 210
IPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFA    211 - 280
SEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN                                 281 - 321
//

Text Mined References (59)

PMID Year Title
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24029231 2013 p53 acts as a safeguard of translational control by regulating fibrillarin and rRNA methylation in cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916032 2012 NOL11, implicated in the pathogenesis of North American Indian childhood cirrhosis, is required for pre-rRNA transcription and processing.
22909121 2012 Influenza A H3N2 subtype virus NS1 protein targets into the nucleus and binds primarily via its C-terminal NLS2/NoLS to nucleolin and fibrillarin.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...