Property Summary

NCBI Gene PubMed Count 53
PubMed Score 1797.80
PubTator Score 75.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.199 1.3e-08
atypical teratoid / rhabdoid tumor 1.600 8.1e-07
cutaneous lupus erythematosus -1.400 2.0e-03
glioblastoma 1.100 1.2e-07
group 3 medulloblastoma 1.900 2.4e-06
intraductal papillary-mucinous neoplasm ... -1.300 1.2e-03
invasive ductal carcinoma -1.353 2.6e-05
lung cancer 1.700 2.4e-03
medulloblastoma, large-cell 2.400 3.8e-06
Multiple myeloma 2.218 2.6e-04
osteosarcoma -1.370 2.2e-03
pediatric high grade glioma 1.200 3.7e-07
primitive neuroectodermal tumor 1.300 1.9e-04
Waldenstrons macroglobulinemia 1.113 7.2e-03

Gene RIF (10)

AA Sequence

MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNR      1 - 70
GRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPF     71 - 140
RSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNI    141 - 210
IPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFA    211 - 280
SEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN                                 281 - 321
//

Text Mined References (63)

PMID Year Title