Property Summary

NCBI Gene PubMed Count 26
Grant Count 57
R01 Count 36
Funding $5,620,983.16
PubMed Score 442.51
PubTator Score 465.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
chronic rhinosinusitis 1.511 0.022
psoriasis -1.100 0.000

Gene RIF (13)

PMID Text
24974109 High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase.
24928513 establish urate as a likely physiological substrate for LPO that will influence host defense and give rise to reactive electrophilic metabolites
23042278 Oral peroxidase activity as a marker of chronic alcohol abuse may help in the diagnosis of alcoholism.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19505917 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19059195 Splice variants may contribute to LPO molecular heterogeneity and its regulation by intracellular compartmental localization in respiratory epithelium.
15894800 Analysis of the role of thiocyanate (SCN-), in modulating the catalytic activity of myeloperoxidase (MPO) and other members of the lactoperoxidase (LPO) and eosinophil peroxidase (EPO)
More...

AA Sequence

MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAMSSETPTSRQL      1 - 70
SEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRT     71 - 140
ITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTPGKTRNGFPLPLAREVSNKIVGYLNEEGVLD    141 - 210
QNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRA    211 - 280
GFVCPTPPYKSLAREQINALTSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKK    281 - 350
PSPCEFINTTARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAF    351 - 420
VQIITFRDYLPILLGDHMQKWIPPYQGYSESVDPRISNVFTFAFRFGHLEVPSSMFRLDENYQPWGPEPE    421 - 490
LPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQPTHRIHGFDLAAINTQRCRD    491 - 560
HGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGLYGTPDNIDIWIGAIAEPLVERGRVGPLLAC    561 - 630
LLGKQFQQIRDGDRFWWENPGVFTNEQKDSLQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCSAID    631 - 700
KLDLSPWASVKN                                                              701 - 712
//

Text Mined References (28)

PMID Year Title
24974109 2014 The assessment of sIgA, histatin-5, and lactoperoxidase levels in saliva of adolescents with dental caries.
24928513 2014 Uric acid and thiocyanate as competing substrates of lactoperoxidase.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23042278 2012 The effect of chronic alcohol intoxication and smoking on the activity of oral peroxidase.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19505917 2009 Lead exposure, polymorphisms in genes related to oxidative stress, and risk of adult brain tumors.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
More...