Property Summary

NCBI Gene PubMed Count 49
PubMed Score 67.52
PubTator Score 63.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.500 2.0e-02
atypical teratoid / rhabdoid tumor -1.600 6.2e-07
Breast cancer 2.800 2.6e-02
breast carcinoma 1.100 2.2e-03
colon cancer 1.600 4.9e-02
dermatomyositis 1.200 6.9e-03
ependymoma -1.600 3.0e-02
gastric cancer 1.100 5.2e-03
glioblastoma -1.300 9.2e-03
hepatocellular carcinoma 1.200 1.1e-05
medulloblastoma, large-cell -1.800 1.4e-06
Multiple myeloma 1.006 4.5e-02
ovarian cancer -1.400 6.2e-04
pancreatic cancer 1.100 5.3e-03
pancreatic carcinoma 1.100 5.3e-03
pancreatic ductal adenocarcinoma liver m... -1.278 1.6e-02
Pick disease -1.100 1.6e-03
primitive neuroectodermal tumor -1.100 2.2e-05
psoriasis 1.300 2.0e-04
tuberculosis and treatment for 6 months -1.100 2.3e-02
Waldenstrons macroglobulinemia 1.687 1.1e-03

Gene RIF (27)

AA Sequence

MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALE      1 - 70
LLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVV     71 - 140
GDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMG    141 - 210
VIYVPLTDKEKQWSRWK                                                         211 - 227
//

Text Mined References (55)

PMID Year Title