Property Summary

NCBI Gene PubMed Count 47
Grant Count 1
Funding $72,970
PubMed Score 65.07
PubTator Score 63.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.100 0.005
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.100 0.005
Waldenstrons macroglobulinemia 1.687 0.001
Multiple myeloma 1.108 0.002
astrocytic glioma -1.500 0.020
ependymoma -1.600 0.030
psoriasis 1.300 0.000
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.100 0.000
tuberculosis and treatment for 6 months -1.100 0.023
pancreatic ductal adenocarcinoma liver m... -1.730 0.009
colon cancer 1.600 0.049
breast carcinoma 1.100 0.002
Breast cancer 2.800 0.026
pancreatic carcinoma 1.100 0.005
Pick disease -1.200 0.001
ovarian cancer 2.300 0.001
dermatomyositis 1.200 0.007

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

1I1N   1KR5  

Gene RIF (25)

PMID Text
26997432 Strong PIMT expression was a predictive marker of poor prognosis for surgically resected lung adenocarcinoma.
25800307 The data of this study indicated that DA-associated PIMT downregulation is an important event contributing to neuronal cell death
24358311 ERK2-mediated phosphorylation of transcriptional coactivator binding protein PIMT/NCoA6IP at Ser298 augments hepatic gluconeogenesis.
23903319 Data indicate that human PROTEIN ISOASPARTYL METHYLTRANSFERASE (PIMT) can initiate isoAsp conversion to Asp, and is able to restore Arabidopsis PRH75's complex biochemical activity provided isoAsp formation has not led to conformational alterations.
23647599 Overexpression of PCMT1 attentuates Mst1 kinase activation and its apoptotic effects in response to hypoxia-induced injury in cardiomyocytes.
22735455 Study provides new insight into the molecular mechanisms by which PIMT suppresses the p53 activity through carboxyl methylation, and suggests a therapeutic target for cancers.
22647835 The results implied that maternal polymorphisms in PCMT1 might be a potential genetic risk factor for isolated anencephaly in the Chinese population of Lvliang.
22382029 PIMT may act as a co-activator in ERalpha-mediated transcription of TFF1 through its recruitment to the promoter via interacting with ERalpha.
22033921 Control of PCMT1 expression by microRNA 15a/16-1 may thus represent a late checkpoint in apoptosis regulation
21841813 A tight cross-regulation exists between ERK and PIMT in regards to their activation and expression during the epithelial mesenchymal transition.
More...

AA Sequence

MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALE      1 - 70
LLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVV     71 - 140
GDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMG    141 - 210
VIYVPLTDKEKQWSRWK                                                         211 - 227
//

Text Mined References (53)

PMID Year Title
26997432 2016 Chaperone protein L-isoaspartate (D-aspartyl) O-methyltransferase as a novel predictor of poor prognosis in lung adenocarcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25800307 2015 The protein l-isoaspartyl (d-aspartyl) methyltransferase protects against dopamine-induced apoptosis in neuroblastoma SH-SY5Y cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24358311 2013 ERK2-mediated phosphorylation of transcriptional coactivator binding protein PIMT/NCoA6IP at Ser298 augments hepatic gluconeogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23903319 2013 An Arabidopsis ATP-dependent, DEAD-box RNA helicase loses activity upon IsoAsp formation but is restored by PROTEIN ISOASPARTYL METHYLTRANSFERASE.
23647599 2013 Protein-L-isoaspartate (D-aspartate) O-methyltransferase protects cardiomyocytes against hypoxia induced apoptosis through inhibiting proapoptotic kinase Mst1.
More...